DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and serpinh1a

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001103844.1 Gene:serpinh1a / 555328 ZFINID:ZDB-GENE-080219-21 Length:403 Species:Danio rerio


Alignment Length:373 Identity:85/373 - (22%)
Similarity:163/373 - (43%) Gaps:17/373 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVA 73
            |...|.....|:|.::.....||::.||..:.:.:.|...|.:..||.::...|...|....::.
Zfish    29 ADNSATLAFNLYQNMAKDKDIENILISPVVVASSLGLVALGGKSNTASQVKTVLSAASVKDEQLH 93

  Fly    74 QTFQFVLEKYRNSN----LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAI 134
            .....:|.:..|..    ..:::|:.|..........:..:.|:.|:.:...|||....:|.:||
Zfish    94 SGLSELLTEVSNPKARNVTWKISNRFYGPSSVSFVDDFLKSSKKHYNYDHSKINFRDKRSAVKAI 158

  Fly   135 NAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINY 199
            |.|.:..|.||:.|:......:|..  :::||:.:|..|..:|..:..:...|.|.....|.:..
Zfish   159 NDWASKSTDGKLPEVTKDVEKTDGA--MIINAMFYKPHWNEQFHHKMVDNRGFLVHRSFTVSVPM 221

  Fly   200 MNQKAKFNYGFFEDL--GCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTV 262
            |::..  .|||.:|.  ....||||......|:.:::|.....:..:.:.|....|......:..
Zfish   222 MHRTG--IYGFLDDTTNKLLVLEMPLAHKMSSLVLIMPYHVESLERVEKLLTRQQLNTWVSAMEQ 284

  Fly   263 EEVHVKFPKFKVDYSLELAEKLKQLGITKMFTD-QAEFSNLLESPEGVFVSKVLHKATIEVNEEG 326
            :.|.:..||..::.|..|.:.|.:||:|:.... :|:.|| :...:.:::|.|.|.:.:|.:.||
Zfish   285 KAVAISLPKVSMEVSHNLQKHLAELGLTEAVDKAKADLSN-ISGKKDLYLSNVFHASAMEWDTEG 348

  Fly   327 TEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKK--NILFAGAFVK 372
            .....:   |..|..:..|..|.||.||::::.:.|  :|||.|..::
Zfish   349 NPPDTS---IFGTDQLKNPKLFYADHPFVFLVKDNKTNSILFMGRLIR 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 84/365 (23%)
serpinh1aNP_001103844.1 SERPIN 26..391 CDD:294093 85/369 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.