DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and SERPINB8

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001353127.1 Gene:SERPINB8 / 5271 HGNCID:8952 Length:374 Species:Homo sapiens


Alignment Length:374 Identity:129/374 - (34%)
Similarity:214/374 - (57%) Gaps:15/374 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPE 71
            :.......|...||::|.......||.|||.||.:.:|:.|.|::|.||.::::||....:  .:
Human     3 DLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKD--GD 65

  Fly    72 VAQTFQFVLEKYRNSN---LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALN-DAAAQ 132
            :.:.||.:|.:...:.   |||.||:|:.::.....|.::...::.|.:|.|.::||.: :...:
Human    66 IHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRK 130

  Fly   133 AINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKI 197
            .||.||..||:|||:|::.|.:....|:|||:||::|||.|..:|..:.|...:|...||::. :
Human   131 HINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKT-V 194

  Fly   198 NYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDL---ADK 259
            ..|.::|||..|:.:::....||:||.:.:|||.:|||.:.|.: |:.||..|......   ::|
Human   195 QMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDL-AVVEKALTYEKFKAWTNSEK 258

  Fly   260 LTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTD-QAEFSNLLESPEGVFVSKVLHKATIEVN 323
            ||..:|.|..|:.|::.|.:|...|::||:...|.: :|:||. :.:.:.|.:|||.||..:|||
Human   259 LTKSKVQVFLPRLKLEESYDLEPFLRRLGMIDAFDEAKADFSG-MSTEKNVPLSKVAHKCFVEVN 322

  Fly   324 EEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAGAF 370
            ||||||||||.::..:|......:|.||.|||:.|.:.|.  |||.|.|
Human   323 EEGTEAAAATAVVRNSRCSRMEPRFCADHPFLFFIRHHKTNCILFCGRF 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 128/366 (35%)
SERPINB8NP_001353127.1 SERPIN 4..374 CDD:320777 129/373 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 232 1.000 Domainoid score I2423
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 233 1.000 Inparanoid score I3423
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm8652
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.