DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and SERPINA4

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001275961.1 Gene:SERPINA4 / 5267 HGNCID:8948 Length:464 Species:Homo sapiens


Alignment Length:394 Identity:108/394 - (27%)
Similarity:185/394 - (46%) Gaps:46/394 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHF--VSN 67
            :|:.|...|.|....:.|:::....:|:.|||.||....|:...|:...:..:|.:.|.|  ...
Human    85 SLKIAPANADFAFRFYYLIASETPGKNIFFSPLSISAAYAMLSLGACSHSRSQILEGLGFNLTEL 149

  Fly    68 FPPEVAQTFQFVLEKYRNSNL------LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFAL 126
            ...:|.:.||.:|   ...||      .||.:.|::....:....:.:.....|.::....||..
Human   150 SESDVHRGFQHLL---HTLNLPGHGLETRVGSALFLSHNLKFLAKFLNDTMAVYEAKLFHTNFYD 211

  Fly   127 NDAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGE 191
            .....|.||..|..:|:|||.:|||  ....:..:||:|.::||..|...|...||....|:|.|
Human   212 TVGTIQLINDHVKKETRGKIVDLVS--ELKKDVLMVLVNYIYFKALWEKPFISSRTTPKDFYVDE 274

  Fly   192 EEQVKINYMNQKAKFNYGFFED--LGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLV 254
            ...|::..|.|..:.:: :..|  |.|:.|.|.|: .|.::|.:||.:  |.....|::.|..::
Human   275 NTTVRVPMMLQDQEHHW-YLHDRYLPCSVLRMDYK-GDATVFFILPNQ--GKMREIEEVLTPEML 335

  Fly   255 D-----LADKLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKV 314
            .     |..:...:::.:..|||.:..|..|.:.|.:||.|.:|:..|:.|.:.:. :.:..||.
Human   336 MRWNNLLRKRNFYKKLELHLPKFSISGSYVLDQILPRLGFTDLFSKWADLSGITKQ-QKLEASKS 399

  Fly   315 LHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQF----------QADRPFLYVIW--NKKNILFA 367
            .||||::|:|.||||||||         :|.::|          :.:||||.||:  :.:::||.
Human   400 FHKATLDVDEAGTEAAAAT---------SFAIKFFSAQTNRHILRFNRPFLVVIFSTSTQSVLFL 455

  Fly   368 GAFV 371
            |..|
Human   456 GKVV 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 105/383 (27%)
SERPINA4NP_001275961.1 alpha-1-antitrypsin_like 91..458 CDD:239011 105/385 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.