DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and SERPINF1

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001316832.1 Gene:SERPINF1 / 5176 HGNCID:8824 Length:418 Species:Homo sapiens


Alignment Length:372 Identity:97/372 - (26%)
Similarity:187/372 - (50%) Gaps:24/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPE 71
            :.|...:.|..:|:::.|:.....||:.||.|:.|.::....|::..|...|.:||::.....|:
Human    53 KLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPD 117

  Fly    72 VAQTFQFVLE----KYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESI--NFALNDAA 130
            :..|::.:|:    ..:|   |:.|:::..::..::|.::.:.:::.|.:....:  |..|:   
Human   118 IHGTYKELLDTVTAPQKN---LKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLD--- 176

  Fly   131 AQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQV 195
            .|.||.||.|:.:||:..  |.....|...::||...||||.|..||...:|..:.|::.||..|
Human   177 LQEINNWVQAQMKGKLAR--STKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTV 239

  Fly   196 KINYMNQ-KAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLV-DLAD 258
            ::..|:. ||...||...||.|...::|...| :|:...||.:.|....|.|:..|...: |:..
Human   240 RVPMMSDPKAVLRYGLDSDLSCKIAQLPLTGS-MSIIFFLPLKVTQNLTLIEESLTSEFIHDIDR 303

  Fly   259 KLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVN 323
            :|...:..:..||.|:.|..|:.:.|:::.:..:| |..:||.:...|  :.:::|.|:|..|.|
Human   304 ELKTVQAVLTVPKLKLSYEGEVTKSLQEMKLQSLF-DSPDFSKITGKP--IKLTQVEHRAGFEWN 365

  Fly   324 EEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAG 368
            |:|.....:.|  :....:||||.:..::||::|:.:...  :||.|
Human   366 EDGAGTTPSPG--LQPAHLTFPLDYHLNQPFIFVLRDTDTGALLFIG 410

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 96/366 (26%)
SERPINF1NP_001316832.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 20..39
PEDF 40..415 CDD:239007 97/372 (26%)
O-glycosylated at one site 371..383 1/13 (8%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.