DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and SERPINA5

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_000615.3 Gene:SERPINA5 / 5104 HGNCID:8723 Length:406 Species:Homo sapiens


Alignment Length:368 Identity:108/368 - (29%)
Similarity:194/368 - (52%) Gaps:28/368 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAK--ALHFVSNFPPEVAQTFQ 77
            ||.:|::.|::....:::.|||.||...:|:...|:...|..:|.:  .|:...:...|:.:.||
Human    48 FTFDLYRALASAAPSQSIFFSPVSISMSLAMLSLGAGSSTKMQILEGLGLNLQKSSEKELHRGFQ 112

  Fly    78 FVLEKY---RNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWVN 139
            .:|::.   |:...|.:.|.|:......|:..:.||:|..|.::....||..:..|.:.||.:|.
Human   113 QLLQELNQPRDGFQLSLGNALFTDLVVDLQDTFVSAMKTLYLADTFPTNFRDSAGAMKQINDYVA 177

  Fly   140 AKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKA 204
            .:|:|||.:|:.  :...|..::::|.:.||..|...|:.:.|:|..|:|..|..|::..|:::.
Human   178 KQTKGKIVDLLK--NLDSNAVVIMVNYIFFKAKWETSFNHKGTQEQDFYVTSETVVRVPMMSRED 240

  Fly   205 KFNYGFFEDLGCTALEMPYQDSDLSMFVL-----LPQERTGIYALAEKLKTVNLVDLADKLTVEE 264
            :::|....:|.|..:.:|||.:..::|:|     :.|...|   |:||    .|..........:
Human   241 QYHYLLDRNLSCRVVGVPYQGNATALFILPSEGKMQQVENG---LSEK----TLRKWLKMFKKRQ 298

  Fly   265 VHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEA 329
            :.:..|||.::.|.:|.:.|..|||:.:||..|:.|. :.:...:.||:::|||.:||:|.||.|
Human   299 LELYLPKFSIEGSYQLEKVLPSLGISNVFTSHADLSG-ISNHSNIQVSEMVHKAVVEVDESGTRA 362

  Fly   330 AAATGMIM---MTRMMTFPLQFQADRPFL-YVIWNKKNILFAG 368
            |||||.|.   ..|:.:..|.|  :|||| :::.|  ||||.|
Human   363 AAATGTIFTFRSARLNSQRLVF--NRPFLMFIVDN--NILFLG 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 108/368 (29%)
SERPINA5NP_000615.3 alpha-1-antitrypsin_like 44..403 CDD:239011 108/368 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.