DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Spn88Ea

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_524954.2 Gene:Spn88Ea / 49804 FlyBaseID:FBgn0028984 Length:427 Species:Drosophila melanogaster


Alignment Length:408 Identity:119/408 - (29%)
Similarity:198/408 - (48%) Gaps:55/408 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFDFNLEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFV 65
            :.|..|...:|...|...:..::......|||.|||:|....:.||:.||.|:|..|:||.||..
  Fly    29 LLDQRLNLYKGQQNFAVSMLNVIRQSTPNENVFFSPYSTYHALLLAYFGSSGDTEKELAKVLHLD 93

  Fly    66 SNFPPEVAQTFQFVLEK-------------YRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHS 117
            .....||.:: .::|||             :.:::.:..||.|:|.|          ..:.:...
  Fly    94 WADSKEVVRS-AYILEKMNRKERQSKMPLEFSSADRIFFANDLHVTE----------CARNRLAE 147

  Fly   118 EAESINF-ALNDAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEER 181
            |.:.|:| :..:.:.:.||.|:..:|..:|..::|||..:..|||||.||.:.||.|..:|..|:
  Fly   148 EVQQIDFKSQTEESRKQINDWIAKQTHDQIRNMLSADEITPRTRLVLANAAYLKGQWLSQFKTEK 212

  Fly   182 TEEDIFWVGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPY---------------QDSDLSMF 231
            |....|:........::.|.||..|.....|.|....|::||               ::||:||.
  Fly   213 TVPMPFYTSPSNYSLVSMMQQKGTFLLNVDEQLRAHVLQLPYRTVFESQEKEDSSPDENSDISMV 277

  Fly   232 VLLPQERTGIYALAEKLKTVNLVDLADKL---TVEEVHVKFPKFKVDYSLELAEKLKQLGITKMF 293
            ::||...:.  :|.:.|..:|...|.|.|   ...|:.|..|||:.:..|||...|.::|::|||
  Fly   278 LILPPFNSN--SLEDVLSRLNADSLDDSLKQAMPREIEVSLPKFEFEQRLELNPILAKMGVSKMF 340

  Fly   294 TDQ-AEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQ---FQADRPF 354
            .:. |.|.:|  :.|.:.:....|.|.|:|:|||:.|||||  ::.|.....|::   |:.:.||
  Fly   341 DESVATFDDL--TSETISIGDSKHVAKIKVDEEGSTAAAAT--VLFTYRSARPVEPAKFECNHPF 401

  Fly   355 LYVIWNK--KNILFAGAF 370
            |:||:::  ::|||.|.:
  Fly   402 LFVIYDRTSRSILFTGIY 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 116/394 (29%)
Spn88EaNP_524954.2 SERPIN 39..419 CDD:238101 117/396 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446288
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140751at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.