DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and serpinf1

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001004539.1 Gene:serpinf1 / 447800 ZFINID:ZDB-GENE-040912-2 Length:406 Species:Danio rerio


Alignment Length:374 Identity:97/374 - (25%)
Similarity:174/374 - (46%) Gaps:30/374 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPE 71
            :.|...:.|...||:.|::...|.:|..||.||.........|:......:|.:||.:.:....:
Zfish    43 KLAAATSDFGYNLFRQLASRDTKASVFLSPMSISAAFTQLSMGASERAEKQIYRALRYHTLQDSQ 107

  Fly    72 VAQTFQFVLEKYR-NSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAIN 135
            :..|.:.:|...| ::...:.|.::.:....:|:..|.:::::||....:.:.....|  .:.:|
Zfish   108 LHDTLRDLLSSLRASAKGFKSAERILLARKLRLRLEYLNSVEKQYGERPQILAGGARD--LKTVN 170

  Fly   136 AWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYM 200
            .|...:|.||:.::|.: ....||.|:.:.:.:|||.|..:|.:....|.....|:...| |..|
Zfish   171 DWFKQQTGGKVDQVVPS-PLPRNTALLPVGSAYFKGKWITRFGKPNKMETFRRDGQAPAV-IPMM 233

  Fly   201 NQKAKFNY----GFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLV-DLADKL 260
            .|:   ||    |...|||||..::|.:|. :||:..||.|.|....|.|:..|...| ||::.|
Zfish   234 EQE---NYPVKMGIDSDLGCTIAQVPMEDG-VSMYFFLPDEVTQNLTLIEEALTAEFVQDLSNSL 294

  Fly   261 TVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEE 325
            ...:|.:..|..|:.|...|...|..||:::... :.:.:.:...|  |.::.|.||..:|...|
Zfish   295 HTVKVLLTLPVIKLSYKTNLLPSLSDLGLSEWLA-ETDLTKITSQP--VKLNAVHHKVVLETAPE 356

  Fly   326 GTEAA----AATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAG 368
            |.|.|    :|||       .:..|.::.|||||:::.::.:  :||.|
Zfish   357 GAEYASTTPSATG-------QSLGLSYRVDRPFLFLVRDEPSGALLFIG 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 96/368 (26%)
serpinf1NP_001004539.1 SERPIN 30..403 CDD:294093 97/374 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.