DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Spn100A

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_651818.1 Gene:Spn100A / 43642 FlyBaseID:FBgn0039795 Length:649 Species:Drosophila melanogaster


Alignment Length:361 Identity:87/361 - (24%)
Similarity:163/361 - (45%) Gaps:54/361 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 SQGETADEIAKALHFVSNFPPEVAQTFQFVLEKYRN-------SNLLRVANKLYVQEGKQL---- 103
            |:.|:..|....|.......|::|.. :...||.:|       |.:..:.....|||.::|    
  Fly   256 SELESQPEETTTLSVEKQEKPDMAAE-ENPAEKQQNKRSDQEESQIKNLEENETVQEEEKLAKIM 319

  Fly   104 -KPA---------------YQSAIKEQYHSEAESINFALND--AAAQAINAWVNAKTQGKITELV 150
             .||               .::|:|......|:.|..||..  .:...:|...:...|..||..:
  Fly   320 AAPALTAGEPEKVRLPLQKLENAVKTAAKDGADEIMLALESHLPSVSRVNGARSLFQQDDITSAL 384

  Fly   151 SADSFS-----DNTRLVLLNALHFKGSWAHKFSEERT-EEDIFWVGEEEQVKINYMNQKAKFNYG 209
            ||:|.:     ..::::|.|.|:::||||:.|.:.|. .::.|::..|:.||...|:.:.||...
  Fly   385 SANSITGRSAGSKSKMLLFNGLYYRGSWANPFYQLRDGSDEFFFMTNEDAVKAPMMHARGKFQVA 449

  Fly   210 FFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTVEEVHVKFPKFKV 274
            ....:....|.:||:.|..::.::||.|..|:..:..:|:|.:.:....:..::|:|:..|||:|
  Fly   450 DLPQVKARVLSLPYETSRYALCIVLPDETEGLSDVISQLQTSDFLLAKKQFQMKELHISMPKFQV 514

  Fly   275 DYSLELAEKLKQLGITKMFT-DQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAAAATGMIMM 338
            :.:......|||:|:.|:|: .:|:.|.|.|.|: |.|.:::....:.|:|.|:.|.:.:...|.
  Fly   515 EETSRSEAMLKQMGLKKVFSRTEAQLSLLSEDPD-VHVDEIVQFVNVRVDEGGSSANSLSAATMQ 578

  Fly   339 TR-----MMTFPL-----------QFQADRPFLYVI 358
            .|     ....|:           :|:.:|||.|.|
  Fly   579 ARTPSVESTVLPVPEPEPELPGVERFEVNRPFAYFI 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 87/361 (24%)
Spn100ANP_651818.1 SERPIN 41..>148 CDD:294093
SERPIN <380..628 CDD:294093 63/236 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.