DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and serpine2

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_956478.1 Gene:serpine2 / 393153 ZFINID:ZDB-GENE-040426-848 Length:395 Species:Danio rerio


Alignment Length:372 Identity:120/372 - (32%)
Similarity:204/372 - (54%) Gaps:15/372 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GARFTS---ELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVA 73
            |||.:.   ::|..:.....:|||:.||..:.:.:.:...|:.|:|..::...|.:..|.|.::.
Zfish    27 GARGSDLGLQVFMQVLQDRAQENVLLSPHGVASVLGMLLPGAHGDTRRQLLNGLKYKKNGPYKML 91

  Fly    74 QTFQFVLEKYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWV 138
            :.....|....|::::.:||.|:..||..:|..:.||.:|.:..|:.|::::..:||||:||.||
Zfish    92 RKLHKSLTTKSNADIVTIANALFPNEGFSMKEDFLSANRENFLCESHSVDYSDPEAAAQSINDWV 156

  Fly   139 NAKTQGKITELVSADSFSDN-TRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQ 202
            ...|:|:|..:|:||.|... ||||.:|::.|||.|..:|..:.|:...|..|:....|:..|:|
Zfish   157 KNSTKGQIPSVVTADMFDTALTRLVAVNSIFFKGLWKSRFQPQSTKPRSFTAGDGNTYKVPMMSQ 221

  Fly   203 KAKFNYGFF---EDLGCTALEMPYQDSDLSMFVLLP-QERTGIYALAEKLKTVNLVDLADKLTVE 263
            .:.||.|..   :......:|:||..:.:|||:.|| ::.|.:.::...:.|..:......:...
Zfish   222 LSVFNMGQASTPDGQKYIVIELPYHGNSMSMFIALPTEDSTPLSSILPHISTNTIQSWTKLMNPR 286

  Fly   264 EVHVKFPKFKVDYSLELAEKLKQLGITKMF-TDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGT 327
            .:.:..|||.|:..|:|...||.|||..:| .::|:|.:|  |.|.::|||.|.||.|||||:||
Zfish   287 RMRLLMPKFTVEQELDLETPLKALGIKDIFDQNKADFRHL--SSESIYVSKALQKAKIEVNEDGT 349

  Fly   328 EAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAGAFVK 372
            :|:|.|.:|:..|  :.|.....|||||::|.:..:  |||||...|
Zfish   350 KASATTSVILHAR--SSPPWVTVDRPFLFLIRHNSSGTILFAGQINK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 118/367 (32%)
serpine2NP_956478.1 PAI-1_nexin-1 26..395 CDD:239006 120/372 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6540
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.