DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and SERPINA2

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_006211.2 Gene:SERPINA2 / 390502 HGNCID:8985 Length:421 Species:Homo sapiens


Alignment Length:364 Identity:100/364 - (27%)
Similarity:180/364 - (49%) Gaps:20/364 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 ELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPE--VAQTFQFVL 80
            :|::.|:......||:.:|.|:....|:...|::.:|..||.:.|:......||  :.:.||.||
Human    63 DLYKELADLSQTSNVLVTPTSVAMAFAMLSLGTKADTRTEILEGLNVNLTETPEAKIHECFQQVL 127

  Fly    81 EKYRNSNL---LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWVNAKT 142
            :.....:.   |...:.|:|.:..:|...:....|:.|||||.||||...:.|.:.||.:|..:|
Human   128 QALSRPDTRLQLTTGSSLFVNKSMKLVDTFLEDTKKLYHSEASSINFRDTEEAKEQINNYVEKRT 192

  Fly   143 QGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKAKFN 207
            ..|:.:||.  ....:|.|.|::.:.|.|.|..||..|....:.|.|.::..:::..:|...:|:
Human   193 GRKVVDLVK--HLKKDTSLALVDYISFHGKWKDKFKAEHIMVEGFHVDDKTIIRVPMINHLGRFD 255

  Fly   208 YGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTVEEVHVKFPKF 272
            .....:|....|...|..:..:.|:|...::  ::.|.|||...:|.::.....:..:::.|||.
Human   256 IHRDRELSSWVLAQHYVGNATAFFILPDPKK--MWQLEEKLTYSHLENIQRAFDIRSINLHFPKL 318

  Fly   273 KVDYSLELAEKLKQLGITKMFTDQAEFSNL-LESPEGVFVSKVLHKATIEVNEEGTEAAAATGMI 336
            .:..:.:|...|:.|||||:|:::|:.|.: .|:|  :.:||.:|.|.:.::|:||||..|..:.
Human   319 SISGTYKLKRVLRNLGITKIFSNEADLSGVSQEAP--LKLSKAVHVAVLTIDEKGTEATGAPHLE 381

  Fly   337 MMTRMMTFPLQFQADRPFLYVIWNKKNI----LFAGAFV 371
            .........:.|  :||||.:|  |.:|    ||.|..|
Human   382 EKAWSKYQTVMF--NRPFLVII--KDDITNFPLFIGKVV 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 99/361 (27%)
SERPINA2NP_006211.2 SERPIN 62..418 CDD:214513 100/364 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.