DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina7

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_808588.3 Gene:Serpina7 / 331535 MGIID:3041197 Length:426 Species:Mus musculus


Alignment Length:375 Identity:116/375 - (30%)
Similarity:191/375 - (50%) Gaps:27/375 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPP--EVAQT 75
            |.|...|::.||......|:.|||.||...:|:...||...|..:|.:.|.|.....|  |:.|.
Mouse    58 ADFAFSLYRRLSVENPDLNIFFSPVSISVALAMLSFGSGSSTQTQILEVLGFNLTDTPVTELQQG 122

  Fly    76 FQFV---LEKYRNSNLLRVANKLYVQEGKQLKP--AYQSAIKEQYHSEAESINFALNDAAAQAIN 135
            ||.:   |...:|...|::.|.:::  |:||||  .:...:|..|.:|..|.:|:...||...||
Mouse   123 FQHLICSLNFPKNELELQMGNAVFI--GQQLKPLAKFLDDVKTLYETEVFSTDFSNVSAAQHKIN 185

  Fly   136 AWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDI-FWVGEEEQVKINY 199
            ::|..:|:|||..|:  .....|..::|:|.:||:..||:.|...:|||.. |.|.:...|::..
Mouse   186 SYVEKQTKGKIVGLI--QGLKLNIIMILVNYIHFRAQWANPFRVSKTEESSNFSVDKSTTVQVPM 248

  Fly   200 MNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIY---ALAEK-LKTVNLVDLADKL 260
            |:|..::.:....:|.||.|:|.|.::.|::|| ||:|....:   |::.| ||..|.  |..|.
Mouse   249 MHQLEQYYHYVDMELNCTVLQMDYSENALALFV-LPKEGHMEWVEAAMSSKTLKKWNY--LLQKG 310

  Fly   261 TVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEE 325
            .||   :..|||.:..:.:|...|:::|:...|.:.|:|..:.|. .|:.:|...|||.:.:.||
Mouse   311 WVE---LFVPKFSISATYDLGSTLQKMGMRDAFAESADFPGITED-SGLKLSYAFHKAVLHIGEE 371

  Fly   326 GTEAAAATGMIMMTRMMTFPLQ--FQADRPFLYVIWNK--KNILFAGAFV 371
            ||:..|:..:..:.:....||.  .:.||.||.:|..|  :::||.|..|
Mouse   372 GTKEGASPEVGSLDQQEVPPLHPVIRLDRAFLLMILEKRTRSVLFLGKLV 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 115/372 (31%)
Serpina7NP_808588.3 alpha-1-antitrypsin_like 57..419 CDD:239011 114/371 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.