DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and serpina1

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_017207927.1 Gene:serpina1 / 322701 ZFINID:ZDB-GENE-030131-1421 Length:433 Species:Danio rerio


Alignment Length:365 Identity:106/365 - (29%)
Similarity:192/365 - (52%) Gaps:18/365 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARFTSELFQLLSAG--GLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVAQT 75
            |.|...|::.|::.  |..:|:.|||..|...::|...|::..|..:|...|.:.:..|.:|.:.
Zfish    71 ADFAFSLYKKLASNPDGQGKNIFFSPVGISMALSLLAVGAKASTLSQIYSGLGYSALTPEQVNEG 135

  Fly    76 FQFVLEKYRNSN---LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAW 137
            ::.:|....:|.   .|.....:.:::|.::...:....:..|:|||..::|:..:.||..||.:
Zfish   136 YEHLLHMLGHSQDAMQLEAGAGVAIRDGFKVVDQFLKDAQHYYNSEAFGVDFSKPEIAAAEINKF 200

  Fly   138 VNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQ 202
            :..||..|||.:|.  ....:|.::|:|.::|:|.|...|..:.|.:..|.|.::..|:::.|.:
Zfish   201 IARKTHDKITNMVK--DLDADTVMMLINYMYFRGKWEKPFDAKLTHKADFKVDQDTTVQVDMMKR 263

  Fly   203 KAKFNYGFFED--LGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTVEEV 265
            ..:  |..::|  ...|.:.:||: .:.||.::||.:.. :..|.|.:...:|.:..|||....|
Zfish   264 TGR--YDIYQDPVNQTTVMMVPYK-GNTSMMIVLPDDGK-MKELEESICRHHLKNWHDKLFRSSV 324

  Fly   266 HVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAA 330
            .:..|||.:..:.:|...||.:|:|..|.|:|:||.:.|..: |.||:|||:|.:.|:|:|||||
Zfish   325 DLFMPKFSISATSKLDGILKDMGMTDAFNDKADFSGMTEEVK-VKVSQVLHQAVMSVDEKGTEAA 388

  Fly   331 AATGMIMMTRMMTFPLQFQADRPFLYVIW--NKKNILFAG 368
            |.|.:.:|.  |:.|.....:||||.:|.  :..:|||.|
Zfish   389 AITTIEIMP--MSLPDTVILNRPFLVLIVEDSTMSILFMG 426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 106/365 (29%)
serpina1XP_017207927.1 alpha-1-antitrypsin_like 69..428 CDD:239011 106/365 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.