DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpine3

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_017171543.1 Gene:Serpine3 / 319433 MGIID:2442020 Length:404 Species:Mus musculus


Alignment Length:375 Identity:98/375 - (26%)
Similarity:179/375 - (47%) Gaps:32/375 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 FARGG------------ARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAK 60
            |:.||            ..|...|::..:|.....|.|.||.|:...:.:...|::|.|..::|.
Mouse    16 FSAGGGSPLSEGLWLLKTEFALHLYRSAAAERNGTNFVISPASVSLSLEILQFGARGNTGWQLAG 80

  Fly    61 ALHFVSNFPPEVAQTFQFVLEKYRNSNL---LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESI 122
            ||.:... .|.|.:....|.....||:.   :.:|..|::|.|..|.|.:...:....:|..|:.
Mouse    81 ALGYTVQ-DPRVKEFLHAVYTTRHNSSQGVGMELACTLFMQTGTSLSPCFVEQVSRWANSSLEAA 144

  Fly   123 NFA-LNDAAAQAINAWVNAKT-QGKITELVS-ADSFSDNTRLVLLNALHFKGSWAHKFSEERTEE 184
            :|: .|....:|........| :|..:.|.. ||:.|  |:|.:::.:.|:.:|..:||.. .:.
Mouse   145 DFSEPNSTTTEASKVTSRQSTGEGPDSPLWGRADALS--TQLSIMSTMTFQSTWQKRFSVV-LQP 206

  Fly   185 DIFWVGEEEQVKINYMNQKAKFNYGFFEDLG---CTALEMPYQDSDLSMFVLLPQERTGIYALAE 246
            ..|.......:::..|:|.|:.:||.|:|..   ...||:.|.....|:.::|||::.......|
Mouse   207 LPFTHAHGLVLQVPAMHQVAEVSYGQFQDAAGHEIAVLELLYLGRVASLLLVLPQDKGTPLDHIE 271

  Fly   247 KLKTVNLVDL-ADKLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNL--LESPEG 308
            ...|..::.| ..:|....:.|..|:||:....::...|:..|||.:| |..: :||  :...:|
Mouse   272 PHLTARVLHLWTTRLKRARMDVFLPRFKIQNQFDVKSILRSWGITDLF-DPLK-ANLKGISGQDG 334

  Fly   309 VFVSKVLHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVI 358
            .:||::.|||.:|::||||.::|||.::::.|..|  ..|:|||||::::
Mouse   335 FYVSQLTHKAKMELSEEGTRSSAATAVLLLRRSRT--SAFKADRPFIFLL 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 95/358 (27%)
Serpine3XP_017171543.1 serpin 20..388 CDD:393296 96/371 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.