DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and RGD1562844

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001333297.1 Gene:RGD1562844 / 306892 RGDID:1562844 Length:296 Species:Rattus norvegicus


Alignment Length:276 Identity:95/276 - (34%)
Similarity:156/276 - (56%) Gaps:14/276 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 EVAQTFQFVLEKYRNSN---LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQ 132
            ::.:.||.:.:|...|.   .||:||.::|.:..::.|.::.:....|:||.|.::||  :||.:
  Rat    15 DIHRGFQLLFKKLNKSERYFSLRMANGIFVDKTCEVLPTFKESCLRFYNSEMEQLSFA--EAAEE 77

  Fly   133 A---INAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQ 194
            :   :|.||:.:|:|||.||:..||....|||||:|||:.|.:|..:|.|..|.|..|.:.:.|.
  Rat    78 SRKHVNTWVSKQTEGKIPELLPDDSVDFQTRLVLVNALYLKATWGRQFDEGSTREMPFKINKNET 142

  Fly   195 VKINYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADK 259
            ..:..|.|:..|.|.:.:::..:.|.:||:..:|...||||.|...|..:.|:|....|......
  Rat   143 RPVQMMYQEGIFCYKYVKEVPASLLMIPYKGDELCFLVLLPDESVDISKVEEELTFEKLTAWTQP 207

  Fly   260 LTVEEVHVK--FPKFKVDYSLELAEKLKQLGITKMFTD-QAEFSNLLESPE-GVFVSKVLHKATI 320
            .|:...||:  .||||::...:|...|::|||...|.: :|:.|.:  :|| .:.|||.:||:.:
  Rat   208 DTMSYTHVEVFLPKFKLEEDYDLKSLLQRLGIVDAFEETKADLSAM--APERNLCVSKFVHKSVV 270

  Fly   321 EVNEEGTEAAAATGMI 336
            ||||:|||||||...:
  Rat   271 EVNEKGTEAAAAASSV 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 95/276 (34%)
RGD1562844NP_001333297.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 228 1.000 Domainoid score I2400
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 229 1.000 Inparanoid score I3374
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - mtm12319
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.