DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and RGD1564786

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006253935.2 Gene:RGD1564786 / 306889 RGDID:1564786 Length:420 Species:Rattus norvegicus


Alignment Length:373 Identity:120/373 - (32%)
Similarity:206/373 - (55%) Gaps:15/373 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 RGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHF---VSNFPPE 71
            :....|..:||::|.. .:.:||.||..||.:.:::...|:.|.||.:|.:|:..   .|....:
  Rat    48 KANGNFAIKLFKVLGE-DISKNVFFSLPSISSALSMILMGANGTTASQICQAMSLDKCNSIGGGD 111

  Fly    72 VAQTFQFVLEKYRNSN---LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINF-ALNDAAAQ 132
            |.|.|..:|.|...::   :||.||.:::::..::..:::.|..:.|.:|.|.::| ...:.:.|
  Rat   112 VHQHFLSLLTKVNKTDTRCMLRKANSVFIEDSFEILASFKDACHKLYEAEIEELDFKGAPEQSRQ 176

  Fly   133 AINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKI 197
            .||.||..||:..|.||:...:.:.||.|.|:|.::||||....|::..|.|..|.|...|:..:
  Rat   177 HINTWVAKKTEDIIRELLPPCTVNSNTCLFLVNVIYFKGSLEKPFNKADTREMPFKVSMNEKKTV 241

  Fly   198 NYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTV 262
            ..|:||:.|...:.:|:....|.:|:::|.|||:..:|........|..:|.....::..|:.|:
  Rat   242 QMMSQKSTFKMTYVKDISTQVLTLPFENSILSMYFFVPDSHVAQRKLENELTYDKFLEWTDEDTM 306

  Fly   263 E--EVHVKFPKFKVDYSLELAEKLKQLGITKMF-TDQAEFSNLLESPEGVFVSKVLHKATIEVNE 324
            |  |:.|..|:.|::.|.::...|::||:|..| .|:|:||. :.|..|:|:|||:||:.:|::|
  Rat   307 EEKEMEVFLPRIKLEESYDMNGVLRKLGMTDAFEEDKADFSG-ISSKHGLFLSKVVHKSFVEMSE 370

  Fly   325 EGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWN--KKNILFAGAF 370
            |||||||.|.::.|...:| |....||.|||:.|.:  .|.|||.|.|
  Rat   371 EGTEAAAPTDVVTMKSPLT-PRCLIADHPFLFSIQDTRSKEILFLGRF 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 119/368 (32%)
RGD1564786XP_006253935.2 SERPIN 46..420 CDD:294093 120/373 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.