DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina3m

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001257911.1 Gene:Serpina3m / 299276 RGDID:735068 Length:419 Species:Rattus norvegicus


Alignment Length:363 Identity:114/363 - (31%)
Similarity:190/363 - (52%) Gaps:18/363 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHF--VSNFPPEVAQTFQ 77
            |...|:::|:.....:||||||.||...:|:...|::|.|.:||.:.|.|  ..::..::.|.|.
  Rat    54 FAFSLYKMLALKNPDKNVVFSPLSISAALAIVSLGAKGNTLEEILEVLRFNLTESYETDIHQGFG 118

  Fly    78 FVLEKYRNSN---LLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINAWVN 139
            .:|::.....   .:...|.|::.:..|:...:|...:..|..||.:.:|.......:.||.:|.
  Rat   119 HLLQRLSQPGDQVKIITGNALFIDKNLQVLAEFQEKTRALYQVEAFTADFQQPRVTEKLINDYVR 183

  Fly   140 AKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMN-QK 203
            .:|||||.||||  ...:.|.:||:|.|.|:|.|...|..:.|.|..|:|.|:..||::.|. ::
  Rat   184 NQTQGKIQELVS--GLKERTSMVLVNYLLFRGKWKVPFDPDYTFESEFYVDEKRSVKVSMMKIEE 246

  Fly   204 AKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKL---TVEEV 265
            ....|...|:|.|:.||:.|..:..::|:|..:.|  :..:...|:...|....|.|   .::|:
  Rat   247 LTTPYFRDEELSCSVLELKYTGNSSALFILPDKGR--MQQVEASLQPETLKKWKDSLRPRKIDEL 309

  Fly   266 HVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAA 330
            ::.......|||||  |.|.:|||..:|:.||:.|.:..:.: :.||:|:||..::|||.|||||
  Rat   310 YLPRLSISTDYSLE--EVLPELGIRDVFSQQADLSRITGAKD-LSVSQVVHKVVLDVNETGTEAA 371

  Fly   331 AATGMIMMTRMMTFPLQFQADRPFLYVI--WNKKNILF 366
            ||||..::.|....|:....:||||..:  .:.:.|||
  Rat   372 AATGANLVPRSGRPPMIVWFNRPFLIAVSHTHGQTILF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 114/363 (31%)
Serpina3mNP_001257911.1 SERPIN 56..416 CDD:214513 113/361 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.