DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinb6e

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006253937.2 Gene:Serpinb6e / 291087 RGDID:1561697 Length:379 Species:Rattus norvegicus


Alignment Length:370 Identity:122/370 - (32%)
Similarity:213/370 - (57%) Gaps:15/370 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 ARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVS---NFPPEVAQ 74
            |.|..::.::|.....| ||.|||.|:.:.:::...|:.|.||.:|:|.|...:   |...:..|
  Rat     9 ATFALKVLRVLGEDSSK-NVFFSPLSMFSSLSMILLGANGTTASQISKVLSLYNCNGNGGGDFHQ 72

  Fly    75 TFQFVLEKYRNS---NLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINF-ALNDAAAQAIN 135
            .||.:|.:...|   ::|:.:|.::|::..::..:::.:.::.|.:|.|:::| ...:.:.|.||
  Rat    73 CFQSLLTEVNKSDRRHMLKTSNSVFVEDSFEILASFKDSCRKFYEAEIENMDFKGAPEQSRQHIN 137

  Fly   136 AWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYM 200
            .||..||:..|.||:|..:.:.||:|||:|:.:|||:|...|::|.|.|..|.|.:.|:..:..|
  Rat   138 TWVAKKTEDVIRELLSPGTVNSNTQLVLMNSFYFKGNWEKPFNKEDTREMPFKVSKNEKKIVQMM 202

  Fly   201 NQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLA--DKLTVE 263
            ..|:.|.....||:..|...:||..:.||:.::||.|...:..:..::....|::..  :.:..|
  Rat   203 FNKSNFRTYHVEDISTTLALLPYLGNQLSITIMLPDEYVELRTVENQITYEKLIEWTRLENMQEE 267

  Fly   264 EVHVKFPKFKVDYSLELAEKLKQLGITKMFTD-QAEFSNLLESPEGVFVSKVLHKATIEVNEEGT 327
            ||.:..|:||::.|.::...|.:||:|..|.| :|:||.:...| |:|:|||:||:.:|||||||
  Rat   268 EVEILLPRFKLEESYDMKNVLCKLGMTNAFEDGRADFSGISSKP-GLFLSKVVHKSVVEVNEEGT 331

  Fly   328 EAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAGAF 370
            ||||.|.::.|...:: |....||.|||::|.:.:|  |||.|.|
  Rat   332 EAAAPTEIVTMGSPLS-PQCLVADHPFLFLIQDDRNKAILFLGRF 375

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 121/368 (33%)
Serpinb6eXP_006253937.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.