DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinf2

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001011892.1 Gene:Serpinf2 / 287527 RGDID:1306692 Length:491 Species:Rattus norvegicus


Alignment Length:389 Identity:107/389 - (27%)
Similarity:180/389 - (46%) Gaps:79/389 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHF-VSNFPPEVAQTFQF 78
            ||::||.|::......|:|.||.|:...::....|::.:|.:.:.:.||. :.:..|.:...|..
  Rat    89 FTTDLFSLVAQTSTSSNLVLSPLSVALALSHLALGARNQTLENLQRVLHMNMGSCIPHLLSHFCQ 153

  Fly    79 VLEKYRNSNLLRVANKLYVQEGKQLKPAY--QS-------AIKEQYHSEAESINFALNDAAAQAI 134
            .|    |...:|:|.::|:|:|..:|..:  ||       .:|.....|.:.:|          |
  Rat   154 NL----NPGTIRLAARIYLQKGFPIKDDFLEQSEKLFGAKPVKLTGRQEEDLMN----------I 204

  Fly   135 NAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINY 199
            |.||...|:|||.:.:|  ...|||.|:||||:||.|.|..||....|::|.|.:.|:..|.:..
  Rat   205 NKWVKEATEGKIEDFLS--ELPDNTVLLLLNAIHFHGFWRTKFDPSLTQKDSFHLDEQFTVPVAM 267

  Fly   200 MN-QKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTV---NLVDLADKL 260
            |: |.....:...|.........|:| :::|..|::|              |.   |:.::...|
  Rat   268 MHAQSYPLRWFLLEQPEIQVAHFPFQ-NNMSFVVIMP--------------TYFGWNVSEVLANL 317

  Fly   261 TVEEVH----------VKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESP-------EG 308
            |.:.::          |:.||..::..|:|...|.:||:..:|          :||       :.
  Rat   318 TWDTLYQPSMREKPTKVRLPKLHLEQHLDLVATLSKLGLQDLF----------QSPDLRGISDQS 372

  Fly   309 VFVSKVLHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKNI---LFAGA 369
            :.||.|.|::|:|::|.|.||||||. ..||||..  ..|..:|||::.|. ::.|   ||.|:
  Rat   373 LVVSSVQHQSTMELSEAGVEAAAATS-TAMTRMSL--SSFFLNRPFIFFIM-EETIGIPLFVGS 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 107/389 (28%)
Serpinf2NP_001011892.1 alpha2AP 82..433 CDD:239008 107/389 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.