DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina3n

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_113719.3 Gene:Serpina3n / 24795 RGDID:3747 Length:418 Species:Rattus norvegicus


Alignment Length:367 Identity:115/367 - (31%)
Similarity:197/367 - (53%) Gaps:23/367 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFP 69
            :|..|.....|...|::.|:.....:||||||.||...:|:...|::|.:.:||.:.|.|.....
  Rat    44 SLTLASINTDFAFSLYKKLALRNPDKNVVFSPLSISAALAVVSLGAKGNSMEEILEGLKFNLTET 108

  Fly    70 P--EVAQTFQFVLEKY---RNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDA 129
            |  |:.:.|..:|::.   |:...:...|.|::::..|:...:|...|..|.:||.:.:|..:..
  Rat   109 PETEIHRGFGHLLQRLSQPRDEIQISTGNALFIEKRLQVLAEFQEKAKALYQAEAFTADFQQSRE 173

  Fly   130 AAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQ 194
            |.:.||.:|:.:|||||..|::  :.:..|.:||:|.::|||.|...|....|.:..|:.|:...
  Rat   174 AKKLINDYVSKQTQGKIQGLIT--NLAKKTSMVLVNYIYFKGKWKVPFDPRDTFQSEFYSGKRRP 236

  Fly   195 VKINYMN-QKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLAD 258
            ||:..|. :.....|...|:|.||.:|:.|..:..::|:|..|.:  :..:...|:...|....|
  Rat   237 VKVPMMKLEDLTTPYVRDEELNCTVVELKYTGNASALFILPDQGK--MQQVEASLQPETLRRWKD 299

  Fly   259 KL---TVEEVHVKFPKFKV--DYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKA 318
            .|   .::|:::  |||.:  ||:||  :.|.:|||.::|:.||:.|. :...:.:.||:|:|||
  Rat   300 SLRPSMIDELYL--PKFSISADYNLE--DVLPELGIKEVFSTQADLSG-ITGDKDLMVSQVVHKA 359

  Fly   319 TIEVNEEGTEAAAATGM--IMMTRMMTFPLQFQADRPFLYVI 358
            .::|.|.|||||||||:  :.|:..:. ||....|||||.:|
  Rat   360 VLDVAETGTEAAAATGVKFVPMSAKLD-PLIIAFDRPFLMII 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 113/359 (31%)
Serpina3nNP_113719.3 serpinA3_A1AC 37..418 CDD:381019 115/367 (31%)
RCL 367..394 12/27 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.