DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinb10

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_006529660.1 Gene:Serpinb10 / 241197 MGIID:2138648 Length:382 Species:Mus musculus


Alignment Length:311 Identity:90/311 - (28%)
Similarity:154/311 - (49%) Gaps:42/311 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LAFAGSQGETADEIAKALHF--VSNFP------------------PEVAQTFQFV---LEKYRNS 86
            :.:.|::|.|||::|:.|.|  |.:|.                  .|:...||.:   :.|..||
Mouse     1 MVYLGTKGTTADQMAQVLQFSSVEDFKSCPDSEKKRKMEFNSGKFEEIQSDFQTLAAEILKPGNS 65

  Fly    87 NLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQ---AINAWVNAKTQGKITE 148
            .:|:.||::|.::.......|...:|..:.:|.:|:||.  :|:.|   .||:||.::|.|||..
Mouse    66 YVLKTANRIYGEKTYPFHNKYLEDMKTYFGAEPQSVNFV--EASGQIRKEINSWVGSQTGGKIPN 128

  Fly   149 LVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKAKFNYGFFED 213
            |:..||....|::||:|||:|||:|.|:||.:.|.|..|.|.:.....:..|:.|........|:
Mouse   129 LLPDDSVDTKTKMVLVNALYFKGTWEHQFSVKSTTERPFRVNKTTSKPVQMMSMKQSLQVFHIEE 193

  Fly   214 LGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVD---LADKLTVEEVHVKFPKFKVD 275
            |....|::.||:.|||:.:|||:...|:..| |:..|...:|   .||.:...||.:..||||::
Mouse   194 LQTIGLQLHYQNRDLSLLLLLPEAIDGLEQL-ERAITYEKLDKWTSADMMDTYEVQLYLPKFKME 257

  Fly   276 YSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVNEEG 326
            .|.:|...|:....:..::.:....:|   |.       ::.||::..:.|
Mouse   258 ESYDLKSALRGQKFSGPYSKENNEDHL---PH-------IYSATLDNQQNG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 90/311 (29%)
Serpinb10XP_006529660.1 serpin 1..>277 CDD:393296 85/278 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.