DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinb13

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_766440.2 Gene:Serpinb13 / 241196 MGIID:3042250 Length:389 Species:Mus musculus


Alignment Length:388 Identity:112/388 - (28%)
Similarity:195/388 - (50%) Gaps:35/388 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GARFTSELFQLLSAGGLKE-------NVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFP 69
            |...|..||.|     .||       ||.|||..|.|.|.:...|::|.||.|:.|.|:......
Mouse     5 GTAATQFLFDL-----FKELNKTNDGNVFFSPVGISTAIGMIILGTRGATASELQKVLYTEQGTE 64

  Fly    70 --------------PEVAQTFQFVL---EKYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHS 117
                          .|:....|.:|   .|:.|...|.::|:|:.::.......|...:::.||:
Mouse    65 SSRIKSEEEEIEKREEIHHQLQMLLTEISKFSNDYDLIISNRLFGEKTYLFLQKYIDYVEKYYHA 129

  Fly   118 EAESINFA-LNDAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEER 181
            ..|.::|. ..|.:.:.||:||.::|..|:.:|....|.:.:|:|||:|.::|||.|..:|.:|.
Mouse   130 SLEPVDFVNAADESRKKINSWVESQTNVKVKDLFPEGSLNSSTKLVLINTVYFKGLWDREFKKEH 194

  Fly   182 TEEDIFWVGEEEQVKINYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAE 246
            |:|:.||:.:.....:..|...:.||:.|.|||....:.:||:::|:|||||||.:..|:..:.:
Mouse   195 TKEEDFWLNKNLSKPVQMMALCSSFNFTFLEDLQAKIVGIPYKNNDISMFVLLPNDIDGLEKIMD 259

  Fly   247 KLKTVNLVDLADKLTVEE--VHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGV 309
            |:....||:......:|:  |.::.|:.:|:.:.:|...|:.:||...|::.|::|. :.:..|:
Mouse   260 KMSPEKLVEWTSPGHLEQRRVDLRLPRLQVEETYDLEPVLEAVGIHSAFSEHADYSG-MSARSGL 323

  Fly   310 FVSKVLHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKK--NILFAGAF 370
            .....||::.:.|.|||.||.|.||:.:.............:.|||:.|.:::  :|||.|.|
Mouse   324 HAQNFLHRSFLVVTEEGVEATAGTGVGLKVSSAASCELVHCNHPFLFFIRHRESDSILFFGKF 386

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 110/385 (29%)
Serpinb13NP_766440.2 SERPIN 4..389 CDD:294093 112/388 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.820

Return to query results.
Submit another query.