DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpine2

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_033281.1 Gene:Serpine2 / 20720 MGIID:101780 Length:397 Species:Mus musculus


Alignment Length:374 Identity:113/374 - (30%)
Similarity:196/374 - (52%) Gaps:12/374 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 FN-LEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSN 67
            || |.....|:....::|..:......||||.||..|.:.:.:...|:.|:|..:::..:.:..|
Mouse    22 FNSLSLEELGSNTGIQVFNQIIKSRPHENVVVSPHGIASILGMLQLGADGKTKKQLSTVMRYNVN 86

  Fly    68 FPPEVAQTFQFVLEKYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQ 132
            ...:|.:.....:...:|.:::.|||.::::.|.:::..:....|:.:..|.:::||....:|::
Mouse    87 GVGKVLKKINKAIVSKKNKDIVTVANAVFLRNGFKMEVPFAVRNKDVFQCEVQNVNFQDPASASE 151

  Fly   133 AINAWVNAKTQGKITELVSADSFSDN-TRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVK 196
            :||.||..:|:|.|..|:|.:..... |||||:||::|||.|..:|..|.|::..|..|:.:..:
Mouse   152 SINFWVKNETRGMIDNLLSPNLIDGALTRLVLVNAVYFKGLWKSRFQPESTKKRTFVAGDGKSYQ 216

  Fly   197 INYMNQKAKFNYGFF---EDLGCTALEMPYQDSDLSMFVLLPQE-RTGIYALAEKLKTVNLVDLA 257
            :..:.|.:.|..|..   ..|....:|:||....:||.:.||.| .|.:.|:...:.|..:....
Mouse   217 VPMLAQLSVFRSGSTRTPNGLWYNFIELPYHGESISMLIALPTESSTPLSAIIPHITTKTIDSWM 281

  Fly   258 DKLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMF-TDQAEFSNLLESPEGVFVSKVLHKATIE 321
            :.:..:.:.:..|||......:|.|.||.||||:|| ..:|.|:.:..| |.:.||.:|.||.||
Mouse   282 NTMVPKRMQLVLPKFTAVAQTDLKEPLKALGITEMFEPSKANFTKITRS-ESLHVSHILQKAKIE 345

  Fly   322 VNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN--ILFAG 368
            |:|:||:|:|||..|::.|  :.|..|..|||||:.|.:...  |||.|
Mouse   346 VSEDGTKASAATTAILIAR--SSPPWFIVDRPFLFSIRHNPTGAILFLG 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 109/364 (30%)
Serpine2NP_033281.1 serpinE2_GDN 21..395 CDD:381039 113/374 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm11110
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
55.030

Return to query results.
Submit another query.