DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina3n

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_033278.2 Gene:Serpina3n / 20716 MGIID:105045 Length:418 Species:Mus musculus


Alignment Length:370 Identity:112/370 - (30%)
Similarity:195/370 - (52%) Gaps:25/370 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHF--VSN 67
            :|..|.....|...|::.|......:|:||||.||...:|:...|::|.|.:||.:.|.|  ...
Mouse    44 SLTLASINTDFAFSLYKELVLKNPDKNIVFSPLSISAALAVMSLGAKGNTLEEILEGLKFNLTET 108

  Fly    68 FPPEVAQTFQFVLEKY---RNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDA 129
            ...::.|.|..:|::.   ::...:...:.|::::.:|:...:|...:..|.:||.:.:|.....
Mouse   109 SEADIHQGFGHLLQRLNQPKDQVQISTGSALFIEKRQQILTEFQEKARALYQAEAFTADFQQPRQ 173

  Fly   130 AAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQ 194
            |.:.||.:|..:|||.|.||||  .....|.:||:|.::||..|...|....|.:..|:.|:...
Mouse   174 AKKLINDYVRKQTQGMIKELVS--DLDKRTLMVLVNYIYFKAKWKVPFDPLDTFKSEFYAGKRRP 236

  Fly   195 VKINYMNQKAKFNYGFF--EDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLA 257
            |.:..|:.: .....:|  |:|.||.:|:.|..:..:||:|..|.:  :..:...|:...|....
Mouse   237 VIVPMMSME-DLTTPYFRDEELFCTVVELKYTGNASAMFILPDQGK--MQQVEASLQPETLRKWK 298

  Fly   258 DKL---TVEEVHVKFPKFKV--DYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHK 317
            :.|   .::|:|:  |||.:  |||||  :.|.:|||.::|:.||:.| .:...:.:.||:|:||
Mouse   299 NSLKPRMIDELHL--PKFSISTDYSLE--DVLSKLGIREVFSTQADLS-AITGTKDLRVSQVVHK 358

  Fly   318 ATIEVNEEGTEAAAATGM--IMMTRMMTFPLQFQADRPFLYVIWN 360
            |.::|.|.|||||||||:  :.|:..: :||....:||||.:|::
Mouse   359 AVLDVAETGTEAAAATGVKFVPMSAKL-YPLTVYFNRPFLIMIFD 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 110/362 (30%)
Serpina3nNP_033278.2 serpinA3_A1AC 37..418 CDD:381019 112/370 (30%)
RCL 367..392 12/25 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.