DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina3g

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_033277.2 Gene:Serpina3g / 20715 MGIID:105046 Length:440 Species:Mus musculus


Alignment Length:372 Identity:119/372 - (31%)
Similarity:199/372 - (53%) Gaps:25/372 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHF-VSNF 68
            :|........|...|::.|......||||||||||.|.:||...|::..|..||.:.|.| ::..
Mouse    34 SLTLVSSNTDFAFSLYRKLVLKNPDENVVFSPFSICTALALLSLGAKSNTLKEILEGLKFNLTET 98

  Fly    69 P-PEVAQTFQFVLE---KYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDA 129
            | |::.|.|:::|:   :..|...:...:.|::::..|:...::...:..|.:||.:.:|.....
Mouse    99 PEPDIHQGFRYLLDLLSQPGNQVQISTGSALFIEKHLQILAEFKEKARALYQAEAFTADFQQPLK 163

  Fly   130 AAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQ 194
            |.:.||.:|:..|||||.:|:|  ...::..:||:|.::|||.|.:.|....|.:..|::.|:..
Mouse   164 ATKLINDYVSNHTQGKIKQLIS--GLKESMLMVLVNYIYFKGKWKNPFDPNDTFKSEFYLDEKRS 226

  Fly   195 VKINYMNQKAKFNY---GFF--EDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLV 254
            |.::.|    |..|   .:|  |:|.||.:|:.|..:..:||:|..|.|  :..:...|:...|.
Mouse   227 VIVSMM----KTGYLTTPYFRDEELSCTVVELKYTGNASAMFILPDQGR--MQQVEASLQPETLR 285

  Fly   255 DLADKLTVEEVH-VKFPKFKV--DYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLH 316
            ...:.|....:| ::.|||.:  |||||  ..|.:|||.::|:.||:.| .:...:.:.||:|:|
Mouse   286 KWKNSLKPRMIHELRLPKFSISTDYSLE--HILPELGIREVFSTQADLS-AITGTKDLRVSQVVH 347

  Fly   317 KATIEVNEEGTEAAAATGMIMMTRMMTFP-LQFQADRPFLYVIWNKK 362
            ||.::|.|:||||||||||..:.....|. |:...:||||.:|.:.|
Mouse   348 KAVLDVAEKGTEAAAATGMAGVGCCAVFDFLEIFFNRPFLMIISDTK 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 118/364 (32%)
Serpina3gNP_033277.2 SERPIN 46..407 CDD:214513 117/360 (33%)
RCL 357..382 12/24 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.