DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinb9b

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_035582.1 Gene:Serpinb9b / 20706 MGIID:894668 Length:377 Species:Mus musculus


Alignment Length:384 Identity:138/384 - (35%)
Similarity:210/384 - (54%) Gaps:48/384 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVAQTFQFV 79
            |...|.::|......:||.|||.||.:.:|:...|::.:||.:|::||.....  ..:.|.|..:
Mouse    11 FAIHLLKMLCQSNPSKNVCFSPVSISSALAMVLLGAKEQTAVQISQALGLKKE--KGIHQGFLKL 73

  Fly    80 LEKY----RNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINF---ALNDAAAQAINAW 137
            |.|.    |..:|: |||:|:..:..::...::.:....|.||.|.:||   |:.  :.|.||.|
Mouse    74 LRKLNKPDRKYSLI-VANRLFADKTCEVLQTFKESCFRFYDSEMEQVNFFKAAVE--SRQCINTW 135

  Fly   138 VNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQ 202
            |:.:|:|||.||::.||.:..|||||:|||:|||.||.:|.:|.|.|..|::.::|:..:..|.|
Mouse   136 VSKQTEGKIPELLADDSVNFQTRLVLVNALYFKGMWACQFCKESTREMPFYINKDEKRPVQMMCQ 200

  Fly   203 KAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTVE---- 263
            ...|.:.|.::|....|.|||:..:||:.||||:            |.|:|..:.:.||.|    
Mouse   201 TDTFMFAFVDELPARLLIMPYEGMELSLMVLLPE------------KGVDLSKVENDLTFEKLIA 253

  Fly   264 ----------EVHVKFPKFKVDYSLELAEKLKQLGITKMF-TDQAEFSNLLESPE-GVFVSKVLH 316
                      ||.|..||||:....|:...|:.|||..:| .::|:.|.:  ||| .:.:||.:|
Mouse   254 WTKPDIMWSTEVKVFLPKFKLQEDYEMKSVLQCLGIVDVFEKEKADLSAM--SPERNLCLSKFIH 316

  Fly   317 KATIEVNEEGTEAAAAT---GMIMMTRMMTFPLQFQADRPFLYVI-WNKKN-ILFAGAF 370
            |:.:||||||||||||:   |:|.:. :...|..|.||.|||:.| .|:.| |||.|.|
Mouse   317 KSVVEVNEEGTEAAAASSAEGIIPLC-LGGGPSWFCADHPFLFFIRHNQTNSILFCGRF 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 137/382 (36%)
Serpinb9bNP_035582.1 SERPIN 4..377 CDD:294093 138/384 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBFJ
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57242
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 1 1.000 - - FOG0000050
OrthoInspector 1 1.000 - - otm44262
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.