DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina1e

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_033273.1 Gene:Serpina1e / 20704 MGIID:891967 Length:413 Species:Mus musculus


Alignment Length:375 Identity:111/375 - (29%)
Similarity:177/375 - (47%) Gaps:19/375 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 EFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHF--VSNFP 69
            |.|.....|...|::.|.......|:.|||.||.|..|:...||:|:|..:|.:.|.|  .....
Mouse    43 EIATNLGDFAISLYRELVHQSNTSNIFFSPVSIATAFAMLSLGSKGDTHTQILEGLQFNLTQTSE 107

  Fly    70 PEVAQTFQFVLEKYR--NSNL-LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAA 131
            .::..:||.:|:...  :|.| |...|.|:|....:|...:....|..|.:|..|:|||.::.|.
Mouse   108 ADIHNSFQHLLQTLNRPDSELQLSTGNGLFVNNDLKLVEKFLEEAKNHYQAEVFSVNFAESEEAK 172

  Fly   132 QAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVK 196
            :.||.:|...|||||.|.|.  ....:|..||.|.:.|||.|...|..|.|::..|.|.|...||
Mouse   173 KVINDFVEKGTQGKIVEAVK--KLEQDTVFVLANYILFKGKWKKPFDPENTKQAEFHVDESTTVK 235

  Fly   197 INYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVD---LAD 258
            :..|......:......|....|.|.|..:..::| |||.:  |.....|:.....|:.   |..
Mouse   236 VPMMTLSGMLDVHHCSTLSSWVLLMDYAGNATAVF-LLPDD--GKMQHLEQTLNKELISKFLLNR 297

  Fly   259 KLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEVN 323
            :..:.::|:  |:..:..:..|...:..||||::|...|:.|.:.|....:.:|:.:|||.:.::
Mouse   298 RRRLAQIHI--PRLSISGNYNLETLMSPLGITRIFNSGADLSGITEENAPLKLSQAVHKAVLTID 360

  Fly   324 EEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIW--NKKNILFAGAFV 371
            |.||||||||  ::....::.|.....:||||::|:  :.::.||.|..|
Mouse   361 ETGTEAAAAT--VLQGGFLSMPPILHFNRPFLFIIFEEHSQSPLFVGKVV 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 108/366 (30%)
Serpina1eNP_033273.1 SERPIN 53..410 CDD:214513 108/365 (30%)
RCL 368..387 4/20 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X28
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.