DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpine1

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_032897.2 Gene:Serpine1 / 18787 MGIID:97608 Length:402 Species:Mus musculus


Alignment Length:382 Identity:115/382 - (30%)
Similarity:183/382 - (47%) Gaps:50/382 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVAQTFQFV 79
            |..::||.:.......||||||:.:.:.:|:....:.|:|..:|..|:.|..|.........|..
Mouse    38 FGVKVFQQVVQASKDRNVVFSPYGVSSVLAMLQMTTAGKTRRQIQDAMGFKVNEKGTAHALRQLS 102

  Fly    80 LEKYR--NSNLLRVANKLYVQEGKQLKPA--------YQSAIKEQYHSEAESINFALNDAAAQAI 134
            .|...  |.|.:..|:.::||...:|...        :|:.:|:...||.|...|.:||      
Mouse   103 KELMGPWNKNEISTADAIFVQRDLELVQGFMPHFFKLFQTMVKQVDFSEVERARFIIND------ 161

  Fly   135 NAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINY 199
              ||...|:|.|::|::..:..:.|||||:|||:|.|.|...|.|..|.:.:|...:...|.:..
Mouse   162 --WVERHTKGMISDLLAKGAVDELTRLVLVNALYFSGQWKTPFLEASTHQRLFHKSDGSTVSVPM 224

  Fly   200 MNQKAKFNYGFF---EDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLT 261
            |.|..||||..|   :.|....:|:|||...||||:..|.|           |.|:|..|.:.|.
Mouse   225 MAQSNKFNYTEFTTPDGLEYDVVELPYQGDTLSMFIAAPFE-----------KDVHLSALTNILD 278

  Fly   262 VEEVH------------VKFPKFKVDYSLELAEKLKQLGITKMFT-DQAEFSNLLESPEGVFVSK 313
            .|.:.            :..|||.::..::|...|::||:..||: ..|:|::|.:. |.:.|::
Mouse   279 AELIRQWKGNMTRLPRLLILPKFSLETEVDLRGPLEKLGMPDMFSATLADFTSLSDQ-EQLSVAQ 342

  Fly   314 VLHKATIEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNK--KNILFAG 368
            .|.|..|||||.||.|:::|..::..||.  |.:...||.||:|:.:.  :.|||.|
Mouse   343 ALQKVRIEVNESGTVASSSTAFVISARMA--PTEMVIDRSFLFVVRHNPTETILFMG 397

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 115/382 (30%)
Serpine1NP_032897.2 SERPIN 29..402 CDD:294093 115/382 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.