DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpinh1

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001104513.1 Gene:Serpinh1 / 12406 MGIID:88283 Length:417 Species:Mus musculus


Alignment Length:369 Identity:91/369 - (24%)
Similarity:160/369 - (43%) Gaps:17/369 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 GARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVAQT- 75
            |..|:  |:|.::.....||::.||..:.:.:.|...|.:..||.: |||:........|...| 
Mouse    48 GLAFS--LYQAMAKDQAVENILLSPLVVASSLGLVSLGGKATTASQ-AKAVLSAEKLRDEEVHTG 109

  Fly    76 FQFVLEKYRNSNLLRV----ANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQAINA 136
            ...:|....||....|    .::||..........:..:.|:.|:.|...|||....:|.|:||.
Mouse   110 LGELLRSLSNSTARNVTWKLGSRLYGPSSVSFADDFVRSSKQHYNCEHSKINFRDKRSALQSINE 174

  Fly   137 WVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMN 201
            |.:..|.||:.|:......:|..  :|:||:.||..|..||..:..:...|.|.....|.:..|:
Mouse   175 WASQTTDGKLPEVTKDVERTDGA--LLVNAMFFKPHWDEKFHHKMVDNRGFMVTRSYTVGVTMMH 237

  Fly   202 QKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLADKLTVEEVH 266
            :...:||...|......:|||......|:.:|:|.....:..|.:.|....|.....|:..:.|.
Mouse   238 RTGLYNYYDDEKEKLQMVEMPLAHKLSSLIILMPHHVEPLERLEKLLTKEQLKAWMGKMQKKAVA 302

  Fly   267 VKFPKFKVDYSLELAEKLKQLGITKMF-TDQAEFSNLLESPEGVFVSKVLHKATIEVNEEGTEAA 330
            :..||..|:.:.:|.:.|..||:|:.. .::|:.|. :...:.::::.|.|....|.:.||....
Mouse   303 ISLPKGVVEVTHDLQKHLAGLGLTEAIDKNKADLSR-MSGKKDLYLASVFHATAFEWDTEGNPFD 366

  Fly   331 AATGMIMMTRMMTFPLQFQADRPFLYVIWNKK--NILFAGAFVK 372
            ..   |.....:..|..|.||.||::::.:.:  ::||.|..|:
Mouse   367 QD---IYGREELRSPKLFYADHPFIFLVRDNQSGSLLFIGRLVR 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 89/364 (24%)
Serpinh1NP_001104513.1 serpinH1_CBP1 35..416 CDD:381003 91/369 (25%)
Prevents secretion from ER. /evidence=ECO:0000305 414..417
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.