DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serpina6

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_031644.1 Gene:Serpina6 / 12401 MGIID:88278 Length:397 Species:Mus musculus


Alignment Length:365 Identity:100/365 - (27%)
Similarity:178/365 - (48%) Gaps:41/365 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNF--------PPE 71
            |...|::.|.|....:|.:.||.||...:|:....::|.|        .::.|.        ..|
Mouse    41 FAFNLYKRLVALNSDKNTLISPVSISMALAMLSLSTRGST--------QYLENLGFNMSKMSEAE 97

  Fly    72 VAQTFQFVLEKYRNSNL---LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAAQA 133
            :.|.||::....:.|:.   :.:.|.:::.:..:||.::.:..|..|.|||.:|.......|.:.
Mouse    98 IHQGFQYLNSLLQQSDTGLEMNMGNVMFLLQNLKLKDSFLADTKHYYESEALTIPSKDWTKAGEQ 162

  Fly   134 INAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKIN 198
            ||..|..||||||..:||  ....:..|:|:|.:..||.|...||.|.|.|:.|:|.|...||:.
Mouse   163 INNHVKNKTQGKIEHVVS--DLDSSATLILINYIFLKGIWKLPFSPENTREEDFYVNETSTVKVP 225

  Fly   199 YMNQKAKFNYGFFED--LGCTALEMPYQDSDLSMFVLLP---QERTGIYALAEKLKTVNLVDLAD 258
            .|.|..  |..:|.|  :.|..::|.|..:. :.|::||   |..|.:.||..     :.:|...
Mouse   226 MMVQSG--NISYFRDSAIPCQMVQMNYVGNG-TTFIILPDQGQMDTVVAALNR-----DTIDRWG 282

  Fly   259 KLTV-EEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLL-ESPEGVFVSKVLHKATIE 321
            ||.: .::::..|||.:..:.:|.:.|..:||..:||:|::|::.. ::|   ....|||||.::
Mouse   283 KLMIPRQMNLYIPKFSMSDTYDLQDVLADVGIKDLFTNQSDFADTTKDTP---LTLTVLHKAMLQ 344

  Fly   322 VNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNK 361
            ::|.....||..|..:.....:|.|::  :|||:::.::|
Mouse   345 LDEGNVLPAATNGPPVHLPSESFTLKY--NRPFIFLAFDK 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 100/365 (27%)
Serpina6NP_031644.1 SERPIN 43..396 CDD:214513 99/363 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D556621at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.