DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and Serping1

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_033906.2 Gene:Serping1 / 12258 MGIID:894696 Length:504 Species:Mus musculus


Alignment Length:369 Identity:93/369 - (25%)
Similarity:167/369 - (45%) Gaps:52/369 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 FTSELFQLLSAGGL-KENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFVSNFPPEVAQTFQF 78
            |:.:|:...||..: |.|:.||||||.:.:.....|:    .|.....|..:.::|.:.|...| 
Mouse   154 FSVKLYHAFSATKMAKTNMAFSPFSIASLLTQVLLGA----GDSTKSNLESILSYPKDFACVHQ- 213

  Fly    79 VLEKYRNSNLLRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALNDAAA--QAINAWVNAK 141
            .|:.:.:..:..| ::::......::..|.:|.:..|.|....:.   .|:||  :.||.||...
Mouse   214 ALKGFSSKGVTSV-SQIFHSPDLAIRDTYVNASQSLYGSSPRVLG---PDSAANLELINTWVAEN 274

  Fly   142 TQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEEEQVKINYMNQKAKF 206
            |..||.:|:  ||...:|.||||||::....|...|..::.....|:  :...:|:..|: ..|:
Mouse   275 TNHKIRKLL--DSLPSDTCLVLLNAVYLSAKWKITFEPKKMMAPFFY--KNSMIKVPMMS-SVKY 334

  Fly   207 NYGFFEDLGCTA----LEMPYQDSDLSMFVLLPQER----------TGIYALAEKLKTVNLVDLA 257
            ....|:|....|    |::.:..|.:.:..:.|:.:          |...|:.:||:....:   
Mouse   335 PVAQFDDHTLKAKVGQLQLSHNLSFVIVVPVFPKHQLKDVEKALNPTVFKAIMKKLELSKFL--- 396

  Fly   258 DKLTVEEVHVKFPKFKVDYS---LELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKAT 319
                  ..::..|..||..|   |.:.|||:...    ||.......|.|.|: :.||.:.|:..
Mouse   397 ------PTYLTMPHIKVKSSQDMLSVMEKLEFFD----FTYDLNLCGLTEDPD-LQVSAMKHETV 450

  Fly   320 IEVNEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKKN 363
            :|:.|.|.|||||:. |...|  :.|: |:..||||:::|::::
Mouse   451 LELTESGVEAAAASA-ISFGR--SLPI-FEVQRPFLFLLWDQQH 490

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 93/369 (25%)
Serping1NP_033906.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 22..67
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..141
serpinG1_C1-INH 141..500 CDD:381006 93/369 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11461
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.