DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Spn55B and serpina10b

DIOPT Version :9

Sequence 1:NP_524953.1 Gene:Spn55B / 49803 FlyBaseID:FBgn0028983 Length:374 Species:Drosophila melanogaster
Sequence 2:XP_009291625.1 Gene:serpina10b / 100003661 ZFINID:ZDB-GENE-100716-5 Length:395 Species:Danio rerio


Alignment Length:376 Identity:108/376 - (28%)
Similarity:186/376 - (49%) Gaps:29/376 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 NLEFARGGARFTSELFQLLSAGGLKENVVFSPFSIQTCIALAFAGSQGETADEIAKALHFV---- 65
            |.:||....|..|.|..        .||||||.|:.||.:.....:||.|..||.|.|:..    
Zfish    35 NTDFAINLYRKISSLHD--------RNVVFSPLSVSTCFSALLLAAQGSTRTEILKGLNLEALDG 91

  Fly    66 --SNFPPEVAQTFQFVLEKYRNSNL-LRVANKLYVQEGKQLKPAYQSAIKEQYHSEAESINFALN 127
              |...||:.|      :.::|.:| :.....|::.:...|:..:...|:..:::|...::|:..
Zfish    92 GDSRRVPELFQ------QLHQNISLQMEQGTALFLDQHFHLQTNFSQQIQRFFNAEVLRVDFSKP 150

  Fly   128 DAAAQAINAWVNAKTQGKITELVSADSFSDNTRLVLLNALHFKGSWAHKFSEERTEEDIFWVGEE 192
            ......||.:|:.||..|:.|::  :|....|:::|||.:.:||.|...|:...||:..|:|.:.
Zfish   151 AVCRSLINEFVSRKTGRKVLEML--ESVEPLTQMLLLNTIFYKGDWERPFNPNNTEKSRFYVDKY 213

  Fly   193 EQVKINYMNQKAKFNYGFFEDLGCTALEMPYQDSDLSMFVLLPQERTGIYALAEKLKTVNLVDLA 257
            ..|::..|..:.||:.....||....|.:||: ...||.:|||.......|:.:::....|....
Zfish   214 NIVQVPMMMLEEKFSVVEDRDLRARVLRLPYR-GGASMLILLPSADADYTAIEDEISAERLHGWI 277

  Fly   258 DKLTVEEVHVKFPKFKVDYSLELAEKLKQLGITKMFTDQAEFSNLLESPEGVFVSKVLHKATIEV 322
            ..:...::.|..|:|::|.|..:.|.|.||||:.:|.|.|:.:.|..... :.||:|||||.|||
Zfish   278 KNMRRMKMEVHLPRFRMDQSYHMHELLPQLGISSVFQDSADLTGLSRDAH-LKVSQVLHKAVIEV 341

  Fly   323 NEEGTEAAAATGMIMMTRMMTFPLQFQADRPFLYVIWNKK--NILFAGAFV 371
            .|:||.||::|.:.:..  .:.|..|..:|||.:.:::::  ::||.|..:
Zfish   342 YEQGTSAASSTSVGITA--YSLPDTFIINRPFFFFLYHEETASLLFMGRVI 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Spn55BNP_524953.1 SERPIN 13..370 CDD:238101 105/365 (29%)
serpina10bXP_009291625.1 Serpin 35..392 CDD:278507 108/376 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.