DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment BomS2 and BomS3

DIOPT Version :10

Sequence 1:NP_725776.1 Gene:BomS2 / 49802 FlyBaseID:FBgn0025583 Length:45 Species:Drosophila melanogaster
Sequence 2:NP_652368.1 Gene:BomS3 / 50209 FlyBaseID:FBgn0040736 Length:39 Species:Drosophila melanogaster


Alignment Length:41 Identity:28/41 - (68%)
Similarity:32/41 - (78%) Gaps:4/41 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFFSVVTVFVFGLLALANAVPLSPDPGNVVINGDCKYCNV 41
            |||.|:  .||.||||||||.||  :||||:|||||:.|||
  Fly     1 MKFLSL--AFVLGLLALANATPL--NPGNVIINGDCRVCNV 37

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
BomS2NP_725776.1 DIM <13..40 CDD:400485 19/26 (73%)
BomS3NP_652368.1 DIM 1..36 CDD:400485 25/38 (66%)

Return to query results.
Submit another query.