DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrcam and tutl

DIOPT Version :9

Sequence 1:XP_017449758.1 Gene:Nrcam / 497815 RGDID:3209 Length:1315 Species:Rattus norvegicus
Sequence 2:NP_001303307.1 Gene:tutl / 46015 FlyBaseID:FBgn0010473 Length:1536 Species:Drosophila melanogaster


Alignment Length:1011 Identity:219/1011 - (21%)
Similarity:354/1011 - (35%) Gaps:293/1011 - (28%)


- Green bases have known domain annotations that are detailed below.


  Rat    24 CQMISALDVPLDHG-EKAKLLDDLVQPPTITQQSPKDYIIDPRENIVIQCEAKGKPPPSFSWTRN 87
            |:.:|.     .|. ||:|......||..|.:|...            :|..             
  Fly    13 CRALST-----QHNTEKSKEQQQQSQPLEIPEQRAS------------KCRG------------- 47

  Rat    88 GTHFDIDKDPLVTMKPGSGTLVINIMSEGKAETYEGVYQCTARNERGAAVSNNIVVRPSR----- 147
                |||:....|: |.|.||.   .|..|...:. |.....|..|..|..::|.| |.|     
  Fly    48 ----DIDRTTTTTI-PASKTLT---ASPAKTAAFT-VKTTRRRRSRRRAEGSSICV-PIRRGQGS 102

  Rat   148 SPLWTKERLEPIILR------------------------SGQSLVLPCRPPIGLP-----PAIIF 183
            :|..|.:.|:.:::.                        .|:.::..|.  :..|     |.::.
  Fly   103 TPTPTIQVLQFVLVSLLALLAKNAQAHNIPEDAVHITAILGEGVIFNCH--VEFPNDHPVPYVLQ 165

  Rat   184 WMDNSFQRLPQSERVSQ-GLNGDLY-FSNVLPEDTREDYICYARFNHTQTIQQKQPI---SLKVI 243
            |          .::||: |.:..:| :....||...|.|     ......:.|..|.   ||.:.
  Fly   166 W----------DKKVSETGSDLPIYIWYESYPEHIEEGY-----KGRVSRVSQDSPFGSASLNLT 215

  Rat   244 SVDELNDTIAANLSDTEFYGAK------SSKER------------PPTF-LTPEG----NESHKE 285
            ::.|         ||..:|..|      ..|:.            ||.| :|||.    |     
  Fly   216 NIRE---------SDQGWYECKVVFLNRDPKQHKNGTWFHLDVHAPPRFSVTPEDIIYVN----- 266

  Rat   286 ELRGNVLSLECIAEGLPTPVIYWIKE--------------DGTLPVNRTFYRNFKKTLQIIHVSE 336
              .|:.:.|.|.|:|.|||.|.|.|:              |||             .|:|..:..
  Fly   267 --LGDSIILNCQADGTPTPEILWYKDANPVDPSPTVGIFNDGT-------------ELRISTIRH 316

  Rat   337 ADSGNYQCIAKNALGAVHHTISVTVKAAPYWIVAPHNLVLSPGENGTLICRANGNP-KPRISWLT 400
            .|.|.|.|||:|..|.|.||..|.:......:|.|.|.....||.....|.|...| ...:.|..
  Fly   317 EDIGEYTCIARNGEGQVSHTARVIIAGGAVIMVPPTNQTKLEGEKVIFSCEAKAMPGNVTVRWYR 381

  Rat   401 NGVPV-EIALDDPSRKIDGD-TIMFSNVQESSSAVYQCNASNKYG-YLLANAFVNVLAEPPRILT 462
            .|.|| |:|..:....|..| :::.:.::...|..|.|..:|..| ...|:|:::|  |.|..:|
  Fly   382 EGSPVREVAALETRVTIRKDGSLIINPIKPDDSGQYLCEVTNGIGDPQSASAYLSV--EYPAKVT 444

  Rat   463 SANTLYQVIANRPALLDCAFFGSPMPTIEWFKGTKGSALHE-----DIYVLHDNGTLEIPVAQKD 522
            ...|:..:......::.|....||.  :::...||...|.|     ||.|: .||:|......::
  Fly   445 FTPTVQYLPFRLAGVVQCYIKSSPQ--LQYVTWTKDKRLLEPYQMKDIVVM-ANGSLLFTRVNEE 506

  Rat   523 STGTYTCVARNKLGM--AKNEVHLEIKDPTRFIKQPEYAVVQR--GSKVSFEC-KVKHDHTLIPT 582
            ..|.|.|...|..|.  |...:.:.::.|..|..:|| .:.||  |..|...| .::.:.|..||
  Fly   507 HQGQYACTPYNAQGTAGASGVMDVLVRKPPAFTVEPE-TLYQRKVGDSVEMHCDALEAEGTERPT 570

  Rat   583 ILWLKDNGELPND---ERFSVDKDHLVVSDVKDEDGGTYTCAANTTLDSVSASAVLRVVAPTPTP 644
            |.|.:..||...:   .|..:...::.:.:::.||.|.|.|..:..:.::.|...| |:..|...
  Fly   571 IKWQRQEGEQLTESQRNRIKISGGNITIENLRREDFGYYQCVVSNEVATLMAVTQL-VIEGTQPH 634

  Rat   645 APIYDVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHEAGLWRHQAEVSGTQT 709
            || |::..        ...:.|:.|.|.||....|       ||:   .:..:|..:|.|:..||
  Fly   635 AP-YNITG--------KATESSITLQWLPGYSGGS-------EYK---QDYTIWFREAGVNDWQT 680

  Rat   710 -------TAQLK---LSPYVNYSFRVMAENSIGRSVPSEASEQYLTKAAEPDQNPTAVEGLGTEP 764
                   :.|:.   |:....|.|:|:..|.:|..:.|:.            .....:|.....|
  Fly   681 ISVTPSGSTQVTINGLASGTTYEFQVVGRNVLGDGMMSKV------------MTVRTLEDAPAAP 733

  Rat   765 DNLVITWKPLNGFQSNGPGLQYKVSWRQKDGDDEWTSVVVANVSKYIVS-GTPTFVPYLIKVQAL 828
            .|:....:|.:.|....|              ||...:...::..:..| ||..:.|..::|:  
  Fly   734 RNVKAATQPPDSFFQLMP--------------DEADLLAYFDIYFHTDSRGTLVYSPPKLRVK-- 782

  Rat   829 NDVGFAPEPAAVMGHSGEDLPMVAPGNVRVSVVN--------STLAEAH--------------WD 871
                 .|:|.             .|.||.|:.|:        |.|..||              |.
  Fly   783 -----GPKPG-------------PPRNVSVTEVSNGFLITWQSPLERAHIVKFYTIKYRTDAQWK 829

  Rat   872 PVPPKSVR--------GHLQGYRIYYWKAQSSSKRN 899
            .:....:|        .:|.|.|.||::..::|:::
  Fly   830 TLNRGQIRPEETQYLVKNLVGGRTYYFRVLANSEKS 865

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrcamXP_017449758.1 IgI_NrCAM 50..144 CDD:409458 18/93 (19%)
Ig strand B 68..72 CDD:409458 0/3 (0%)
Ig strand C 81..85 CDD:409458 0/3 (0%)
Ig strand E 106..110 CDD:409458 2/3 (67%)
Ig strand F 124..129 CDD:409458 1/4 (25%)
Ig strand G 138..141 CDD:409458 0/2 (0%)
Ig 153..242 CDD:416386 18/122 (15%)
Ig strand A 153..156 CDD:409353 0/2 (0%)
Ig strand A' 158..162 CDD:409353 0/3 (0%)
Ig strand B 165..173 CDD:409353 1/7 (14%)
Ig strand C 180..186 CDD:409353 1/5 (20%)
Ig strand C' 189..192 CDD:409353 0/2 (0%)
Ig strand D 198..202 CDD:409353 2/4 (50%)
Ig strand E 204..208 CDD:409353 1/4 (25%)
Ig strand F 219..227 CDD:409353 1/7 (14%)
Ig strand G 230..242 CDD:409353 4/14 (29%)
Ig 281..362 CDD:416386 28/94 (30%)
Ig strand B 292..296 CDD:409353 1/3 (33%)
Ig strand C 305..309 CDD:409353 1/3 (33%)
Ig strand E 327..331 CDD:409353 1/3 (33%)
Ig strand F 341..346 CDD:409353 2/4 (50%)
Ig strand G 354..357 CDD:409353 1/2 (50%)
Ig 366..454 CDD:416386 23/91 (25%)
Ig strand B 382..386 CDD:409353 0/3 (0%)
Ig strand C 395..399 CDD:409353 0/3 (0%)
Ig strand E 419..423 CDD:409353 1/4 (25%)
Ig strand F 433..438 CDD:409353 2/4 (50%)
Ig strand G 446..449 CDD:409353 1/2 (50%)
Ig 460..546 CDD:416386 21/92 (23%)
Ig strand A 460..463 CDD:409353 0/2 (0%)
Ig strand A' 467..470 CDD:409353 0/2 (0%)
Ig strand B 476..483 CDD:409353 1/6 (17%)
Ig strand C 489..494 CDD:409353 0/4 (0%)
Ig strand C' 496..498 CDD:409353 1/1 (100%)
Ig strand D 505..509 CDD:409353 2/3 (67%)
Ig strand E 512..517 CDD:409353 2/4 (50%)
Ig strand F 525..533 CDD:409353 3/7 (43%)
Ig strand G 536..546 CDD:409353 2/11 (18%)
Ig 553..637 CDD:416386 22/89 (25%)
Ig strand A 553..556 CDD:409353 0/2 (0%)
Ig strand A' 558..562 CDD:409353 0/3 (0%)
Ig strand B 565..574 CDD:409353 2/9 (22%)
Ig strand C 582..587 CDD:409353 3/4 (75%)
Ig strand C' 590..593 CDD:409353 2/2 (100%)
Ig strand D 597..602 CDD:409353 1/4 (25%)
Ig strand E 603..609 CDD:409353 0/5 (0%)
Ig strand F 616..624 CDD:409353 3/7 (43%)
Ig strand G 627..637 CDD:409353 2/9 (22%)
FN3 651..741 CDD:238020 21/99 (21%)
fn3 754..836 CDD:394996 13/82 (16%)
fn3 852..944 CDD:394996 17/78 (22%)
fn3 957..1041 CDD:394996
fn3 1075..1143 CDD:394996
Bravo_FIGEY 1198..1287 CDD:404722
tutlNP_001303307.1 V-set 137..250 CDD:284989 23/138 (17%)
IG_like 137..229 CDD:214653 21/117 (18%)
I-set 253..341 CDD:254352 34/107 (32%)
IGc2 268..331 CDD:197706 23/75 (31%)
I-set 346..437 CDD:254352 23/90 (26%)
Ig 349..437 CDD:299845 23/87 (26%)
Ig 459..530 CDD:299845 19/73 (26%)
IG_like 549..628 CDD:214653 18/79 (23%)
IGc2 551..617 CDD:197706 16/65 (25%)
FN3 633..725 CDD:238020 24/122 (20%)
FN3 786..874 CDD:238020 18/93 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.