DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrcam and Dscam2

DIOPT Version :9

Sequence 1:XP_017449758.1 Gene:Nrcam / 497815 RGDID:3209 Length:1315 Species:Rattus norvegicus
Sequence 2:NP_001261500.1 Gene:Dscam2 / 38788 FlyBaseID:FBgn0265296 Length:2101 Species:Drosophila melanogaster


Alignment Length:1395 Identity:348/1395 - (24%)
Similarity:516/1395 - (36%) Gaps:355/1395 - (25%)


- Green bases have known domain annotations that are detailed below.


  Rat    46 LVQPPTITQQSPKDYIIDPR-------------ENIVIQCEAKGKPPPSFSW-TRNGTHFDIDKD 96
            :|..||..:.:....||.|.             |..|:.|.|:|.|.|.:|| |.||.      .
  Fly   220 VVSSPTRLRINSHRGIISPSVVEHTAHVQVSQDEGAVLLCVAQGCPSPEYSWFTHNGA------G 278

  Rat    97 PLVTMKPGSGTLVINIMSEGKAETYE--GVYQCTARNERG-AAVSNNIVVRPSRSPLWTKERLEP 158
            ||..:. |....::..:...:|.|.|  |||:|||.|..| |:....:.|   .:|:  :..:.|
  Fly   279 PLPVLS-GPRVRLLGPILAIEAVTGEDSGVYKCTAGNVGGEASAELRLTV---ATPI--QVEISP 337

  Rat   159 IIL-------RSGQSLVLPCRPPIGLPPAIIFWMDNSFQRLPQSERVSQGLNGDLYFSNVLPEDT 216
            .:|       ...:.||.....|:|:..  |.|..:. ::||.|.||...|        |:|..:
  Fly   338 NVLSVHMGGTAEFRCLVTSNGSPVGMQN--ILWYKDG-RQLPSSGRVEDTL--------VVPRVS 391

  Rat   217 RED---YICYARFNHTQTIQQKQPISLKVISVDELNDTIAANLSDTEFYGAKSSKERPPTFLTPE 278
            ||:   |.|..|.....|.|.                |....|.|.           ||..|   
  Fly   392 RENRGMYQCVVRRPEGDTFQA----------------TAELQLGDA-----------PPVLL--- 426

  Rat   279 GNESHKEEL--RGNVLSLECIAEGLPTPVIYWIKEDGTLPVNRTF--------YRNFKKTLQIIH 333
              .|..|:.  .|..:||:|.|.|.|||.|.|..:...||.|..|        :.:....:.|.|
  Fly   427 --YSFIEQTLQPGPAVSLKCSAAGNPTPQISWTLDGFPLPSNGRFMIGQYITVHGDVISHVNISH 489

  Rat   334 VSEADSGNYQCIAKNALGAVHHTISVTVKAAPYWIVAPHNLVLSPGENGTLICRANGNPKPRISW 398
            |...|.|.|.|||:|..|.|.|...:.:...||..:.|....:| ||...|.|...|.|...|.|
  Fly   490 VMVEDGGEYACIAENRAGRVQHAARLNIYGLPYIRLIPKVTAVS-GETLNLKCPVAGYPIEEIHW 553

  Rat   399 LTNG--VPVEIALDDPSRKIDGD-TIMFSNVQESS-SAVYQCNASNKYGYLLANAFVNVLAEPPR 459
            ...|  :|     ||..:::..| ::..|.||::| |.||.|.|.||.|:....:....:..||:
  Fly   554 ERGGRELP-----DDIRQRVQPDGSLTISPVQKNSDSGVYTCWARNKQGHSARRSGEVTVIVPPK 613

  Rat   460 ILTSANTLYQVIANRPALLDCAFFGSPMP-TIEWFKGTKG-------SALHEDIYVLHDNGTLEI 516
            :......:.|:.....|.|.|:.....:| ||.|.|..:.       |....|.|    |..|.|
  Fly   614 LSPFQTNILQLNMGDRASLTCSVVKGDLPLTINWRKDGRPIDPTQHMSVKQVDQY----NSILVI 674

  Rat   517 PVAQKDSTGTYTCVARNKLGMAKNEVHLEIKDPTRFIKQPEYAVVQRGSKVSFECKVKHDHTLIP 581
            .....|.||.|:||.||.....:|...|.:..|.|:|.:|..|.|:|...:...|:.:...|  |
  Fly   675 ENLGSDHTGNYSCVVRNSAAEVENSQALLVNVPPRWIVEPVDANVERNRHIMLHCQAQGVPT--P 737

  Rat   582 TILWLKDNG------ELPNDERFS--VDKDHLVVSDVKDEDGGTYTCAAN--------------- 623
            :|:|.|..|      |...:..|:  :....|::..||::..|.|.|.||               
  Fly   738 SIVWKKATGSKSGEYEEVRERPFTKLLGNGSLLLQHVKEDREGFYLCQANNGIGTGIGKVIQLKV 802

  Rat   624 ----------------------------------------------------------TTLDSVS 630
                                                                      .|.|.||
  Fly   803 NSSPYFSSTSRSVMVKKGDTALLQCAVSGDKPINIVWMRSGKNTLNPSTNYKISVKQEATPDGVS 867

  Rat   631 ASAVLRVVAPTPT------------------PAPIYDVPNPPFDLELTNQLDKSVQLTWTPGDDN 677
            |...:|.|..|.:                  ...:.:.|.||..||......:||.:.|.|....
  Fly   868 AELQIRTVDATDSGPYFCRASNLYGNDQQLVQLQVQEPPLPPSVLEAAMISSRSVNIKWQPKTLG 932

  Rat   678 NSPITKFIIEYEDAMHE------AGLWRHQAEVSG-TQTTAQLK-LSPYVNYSFRVMAENSIGRS 734
            ...:||:|:|:.:|.|.      ...|: |.||.. ....|.:: |.|...|:|||:||.|.|||
  Fly   933 TGDVTKYIVEFREADHSLPPALFVDQWQ-QIEVKDPPHFNAMIENLKPATRYAFRVIAEGSAGRS 996

  Rat   735 VPSEASEQYLTKAAEPDQ---NPTAVEGLGTEPDNLVITW-KPLNGFQS---NGPGLQYKVS--- 789
            .||    |.|....||.:   .|.::.........|:|:| .||...:.   .|..:.||:|   
  Fly   997 APS----QELIVRTEPQRPAGPPLSLSARPLSSTELLISWVAPLPELRHGDIQGYNVGYKLSSSG 1057

  Rat   790 -----WRQKDGDDEWTSVVVANVSKYIVSGTPTFVPYLIKVQALNDVGFAP--EPAAVMGHSGED 847
                 :....||.:      ....:.::||...|..|.:.|||.|.||..|  ||.|  ..:.||
  Fly  1058 NTAYNFTSVSGDGD------GGNGELLLSGLAKFARYTVVVQAFNQVGPGPLSEPTA--AQTMED 1114

  Rat   848 LPMVAPGNVRVSVVNSTLAEAHWDPVPPKSVRGHLQGYRIYYWKAQSSSKRNRRHIEKKILTFQG 912
            :|...|.:||.:.::|...:..|.|.|.....|.||||::.:.......:.::..:|.:      
  Fly  1115 VPSRPPEDVRCAALSSQSLQVSWQPPPIYHTNGLLQGYKLIFEPIIDDIQPSKDEVESR------ 1173

  Rat   913 SKTHGM---LPGLQPYSHYVLNVRVVNGKGEGPASADRGFHTPEGVPSAPSSLKIVNPTLDSLTL 974
             ||..:   |.||:.|::|.:.|......|:|..|.....|:.|.||.||:.:|:|:.:..||.:
  Fly  1174 -KTTALTMVLTGLRKYTNYSIQVLAHTRMGDGVVSKPLFCHSEEDVPEAPADIKVVSSSSQSLYI 1237

  Rat   975 EWDPPSHPNGILTEYILKYQPINSTHELGPLVDLKIPANKTRWTLKNLNFSTRYKFYFYAQTSVG 1039
            .|.||:.|||::|:|.|..:.:|...||.. ....:|:.:..:..|.|:....|:|:..|.|.||
  Fly  1238 SWLPPNEPNGVITKYSLYTRVVNGREELNN-EKRSLPSQQAYYEAKGLHPHMEYQFWVTASTRVG 1301

  Rat  1040 SG------SQITEEAI-----------------------TTVDEGKK------------------ 1057
            .|      ||||...|                       |.|.:.|:                  
  Fly  1302 EGKSSRVSSQITTNRIPARIISFGGPVVRPWRSTVTLPCTAVGKPKREWFKSDVALRQGGLHNSQ 1366

  Rat  1058 ---AGIL---------------PPDVGAGKVRAVSPRIGNVTAAAAETYAN--------ISWE-- 1094
               :|.|               ..|.|.|..|.....|..|...|...|..        :.|:  
  Fly  1367 LLDSGDLIISSLQLADGGNYSCQVDNGIGTDRLTHTLIVQVPPTAPVLYVTSATSSSILMHWKCG 1431

  Rat  1095 YEGPEHVKFYVEY--GVAGSKEEWRKEIVNGSRSFFGLKGLMPGTAYKVRVGAEGDSGFVSSEDV 1157
            :.|...:..|..:  ...|:.:|.:   ::...|...|||||.|:.|::.:.|:...|       
  Fly  1432 FTGNAPITGYTLFYRRANGNTDEMQ---LSRHASSHELKGLMCGSTYQIHLSAQNKVG------- 1486

  Rat  1158 FETGPAMASRQVDIATQGWFIGLMCAVALL 1187
              |.|  .|..:.:.|||...|...:.|||
  Fly  1487 --TSP--TSTILHVRTQGQSPGHPASTALL 1512

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrcamXP_017449758.1 IgI_NrCAM 50..144 CDD:409458 32/110 (29%)
Ig strand B 68..72 CDD:409458 1/3 (33%)
Ig strand C 81..85 CDD:409458 2/4 (50%)
Ig strand E 106..110 CDD:409458 0/3 (0%)
Ig strand F 124..129 CDD:409458 3/4 (75%)
Ig strand G 138..141 CDD:409458 0/2 (0%)
Ig 153..242 CDD:416386 23/98 (23%)
Ig strand A 153..156 CDD:409353 0/2 (0%)
Ig strand A' 158..162 CDD:409353 2/10 (20%)
Ig strand B 165..173 CDD:409353 2/7 (29%)
Ig strand C 180..186 CDD:409353 2/5 (40%)
Ig strand C' 189..192 CDD:409353 0/2 (0%)
Ig strand D 198..202 CDD:409353 1/3 (33%)
Ig strand E 204..208 CDD:409353 0/3 (0%)
Ig strand F 219..227 CDD:409353 3/10 (30%)
Ig strand G 230..242 CDD:409353 2/11 (18%)
Ig 281..362 CDD:416386 30/90 (33%)
Ig strand B 292..296 CDD:409353 2/3 (67%)
Ig strand C 305..309 CDD:409353 1/3 (33%)
Ig strand E 327..331 CDD:409353 0/3 (0%)
Ig strand F 341..346 CDD:409353 2/4 (50%)
Ig strand G 354..357 CDD:409353 1/2 (50%)
Ig 366..454 CDD:416386 28/91 (31%)
Ig strand B 382..386 CDD:409353 1/3 (33%)
Ig strand C 395..399 CDD:409353 1/3 (33%)
Ig strand E 419..423 CDD:409353 1/4 (25%)
Ig strand F 433..438 CDD:409353 3/4 (75%)
Ig strand G 446..449 CDD:409353 0/2 (0%)
Ig 460..546 CDD:416386 25/93 (27%)
Ig strand A 460..463 CDD:409353 0/2 (0%)
Ig strand A' 467..470 CDD:409353 0/2 (0%)
Ig strand B 476..483 CDD:409353 3/6 (50%)
Ig strand C 489..494 CDD:409353 3/4 (75%)
Ig strand C' 496..498 CDD:409353 0/1 (0%)
Ig strand D 505..509 CDD:409353 1/3 (33%)
Ig strand E 512..517 CDD:409353 1/4 (25%)
Ig strand F 525..533 CDD:409353 4/7 (57%)
Ig strand G 536..546 CDD:409353 2/9 (22%)
Ig 553..637 CDD:416386 27/164 (16%)
Ig strand A 553..556 CDD:409353 1/2 (50%)
Ig strand A' 558..562 CDD:409353 1/3 (33%)
Ig strand B 565..574 CDD:409353 1/8 (13%)
Ig strand C 582..587 CDD:409353 2/4 (50%)
Ig strand C' 590..593 CDD:409353 2/8 (25%)
Ig strand D 597..602 CDD:409353 1/6 (17%)
Ig strand E 603..609 CDD:409353 1/5 (20%)
Ig strand F 616..624 CDD:409353 5/80 (6%)
Ig strand G 627..637 CDD:409353 4/9 (44%)
FN3 651..741 CDD:238020 34/97 (35%)
fn3 754..836 CDD:394996 23/95 (24%)
fn3 852..944 CDD:394996 23/94 (24%)
fn3 957..1041 CDD:394996 27/83 (33%)
fn3 1075..1143 CDD:394996 17/79 (22%)
Bravo_FIGEY 1198..1287 CDD:404722
Dscam2NP_001261500.1 Ig 51..127 CDD:299845
Ig 138..>203 CDD:299845
I-set 238..327 CDD:254352 28/95 (29%)
Ig 247..327 CDD:299845 27/86 (31%)
I-set 332..418 CDD:254352 24/112 (21%)
IGc2 344..407 CDD:197706 19/73 (26%)
IG_like 432..517 CDD:214653 28/84 (33%)
IGc2 436..507 CDD:197706 25/70 (36%)
I-set 521..610 CDD:254352 29/94 (31%)
IGc2 533..597 CDD:197706 25/69 (36%)
Ig 630..699 CDD:143165 22/72 (31%)
IG_like 714..802 CDD:214653 21/89 (24%)
Ig 725..802 CDD:299845 17/78 (22%)
Ig 823..894 CDD:143165 8/70 (11%)
FN3 906..1006 CDD:238020 36/104 (35%)
FN3 1013..1111 CDD:238020 26/105 (25%)
FN3 1119..1209 CDD:238020 24/96 (25%)
FN3 1219..1313 CDD:238020 31/94 (33%)
Ig 1336..1402 CDD:143165 9/65 (14%)
FN3 1409..1498 CDD:238020 20/102 (20%)
FN3 1515..1588 CDD:238020
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.