DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nrcam and bdl

DIOPT Version :9

Sequence 1:XP_017449758.1 Gene:Nrcam / 497815 RGDID:3209 Length:1315 Species:Rattus norvegicus
Sequence 2:NP_608822.1 Gene:bdl / 33635 FlyBaseID:FBgn0028482 Length:719 Species:Drosophila melanogaster


Alignment Length:659 Identity:148/659 - (22%)
Similarity:251/659 - (38%) Gaps:159/659 - (24%)


- Green bases have known domain annotations that are detailed below.


  Rat   302 PTP-VIYWIKEDGTLPVNRTFYRNFKKTLQIIH---------------------VSEADSGNYQC 344
            |.| :::|.|::..:   .|:|.....|.::.:                     :.|:|.|.|.|
  Fly    64 PIPYLVHWTKDNKKI---FTWYEQETSTSELFNGRLHLVENHPEFGRASVNLTAIRESDQGWYHC 125

  Rat   345 ----------IAKNALGAVHHTISVTVKAAPYWIVAPHNLVLSPGENGTLICRANGNPKPRISWL 399
                      :..|  |..:|   :.|:......:.|.|..:..|:.....|........:.||.
  Fly   126 QVSFPN
RSPSVRNN--GTAYH---LAVQGGSLIRIPPVNQTIREGQTAFFHCVMKHPENSQASWY 185

  Rat   400 TNGVPVEIALD-------DPSRKIDGDTIMFSNVQESSSAVYQCNASNKYGYL-LANAFVN---- 452
            .:||.::...|       .|...:..|..|.|::.|     |:|...|..|.| .|.||:|    
  Fly   186 KDGVLLQEVQDLVRRFYMGPDGSLSIDPTMMSDLGE-----YECKVRNSDGELQTAKAFLNIQYK 245

  Rat   453 --VLAEPPRILTSANTLYQVIANRPALLDCAFFGS-PMPTIEWFKGTKGSALHEDIY----VLHD 510
              |:..||.:.        :...:||:|||.|..: |:..:.|.|    ..|..|.|    |.:.
  Fly   246 AKVIYAPPEVF--------LPYGQPAVLDCHFRANPPLKNLRWEK----DGLLFDSYNVPGVFYK 298

  Rat   511 -NGTLEIPVAQKDSTGTYTCVARNKLGM--AKNEVHLEIKDPTRFIKQPEYAVVQR-GSKVSFEC 571
             ||:|......::..|:|||...|.||.  ....:.:.:..|..|...|:...:|: |......|
  Fly   299 MNGSLFFAKVDENHAGSYTCTPYNDLGTDGPSPVISVIVLRPPIFSVTPKAIYIQKLGEAAELPC 363

  Rat   572 K-VKHDHTLIPTILW-LKDNGELPNDERFSVDKDHLVVSDVKDEDGGTYTCAANTTLDSVSASAV 634
            : :..|....|:|:| .||...||.| |||:...:|.::.:.:.|.|.|.|:|.....:::|.|.
  Fly   364 EAIDRDGNNRPSIIWGRKDGQPLPAD-RFSLSGGNLTITGLVEGDRGIYECSATNEAATITAEAE 427

  Rat   635 LRV--VAPTPTPAPIYDVPNPPFDLELTNQLDKSVQLTWTPGDDNNSPITKFIIEYEDAMHEAGL 697
            |.:  :|           |..|::| ..|..:..:.:.|.||  ...|..::.:.|.  :.||..
  Fly   428 LMIENIA-----------PRAPYNL-TANSTETCITIRWQPG--YLRPNLEYTVWYR--LMEAPE 476

  Rat   698 WR--HQAEVSGTQTTAQLKLSPYVNYSFRVMAENSIG----------RSVPSE-ASEQYLTKAAE 749
            ||  ...:....:.|.| .|.|...|.|.|::::..|          :::||. .::.:..:..:
  Fly   477 WRTLRVLDKKVMEATVQ-HLQPGKEYEFMVLSQDKYGDGMFSKQFRFQTLPSPIRADDFDAQQLQ 540

  Rat   750 PD--QNPTAVEGLGTEPDNL---------VITWK-PLNGFQSNGPGLQ-YKVSWRQKDGDDEWTS 801
            .|  |......|||. |.||         ::.|: |:.|.:    ||: |.|.|        |  
  Fly   541 HDLGQVTAPAGGLGA-PWNLTAISNQQGWLLHWEHPVQGLE----GLRLYAVRW--------W-- 590

  Rat   802 VVVANVSKYIVSGTPTFVPY----------LIKVQALNDVGFAPEPAAVMGHSGEDLPMVAPGNV 856
               .....:::....||..|          |.|||.| .||...:.:........|:|  :...|
  Fly   591 ---KEPEHFLIGHAETFDNYYQLRHLKEDTLFKVQVL-AVGTETQQSVPSHELLIDVP--SQRKV 649

  Rat   857 RVSVVNSTL 865
            |..::.|::
  Fly   650 RALIIGSSV 658

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NrcamXP_017449758.1 IgI_NrCAM 50..144 CDD:409458
Ig strand B 68..72 CDD:409458
Ig strand C 81..85 CDD:409458
Ig strand E 106..110 CDD:409458
Ig strand F 124..129 CDD:409458
Ig strand G 138..141 CDD:409458
Ig 153..242 CDD:416386
Ig strand A 153..156 CDD:409353
Ig strand A' 158..162 CDD:409353
Ig strand B 165..173 CDD:409353
Ig strand C 180..186 CDD:409353
Ig strand C' 189..192 CDD:409353
Ig strand D 198..202 CDD:409353
Ig strand E 204..208 CDD:409353
Ig strand F 219..227 CDD:409353
Ig strand G 230..242 CDD:409353
Ig 281..362 CDD:416386 15/91 (16%)
Ig strand B 292..296 CDD:409353
Ig strand C 305..309 CDD:409353 0/3 (0%)
Ig strand E 327..331 CDD:409353 1/3 (33%)
Ig strand F 341..346 CDD:409353 2/14 (14%)
Ig strand G 354..357 CDD:409353 1/2 (50%)
Ig 366..454 CDD:416386 23/101 (23%)
Ig strand B 382..386 CDD:409353 0/3 (0%)
Ig strand C 395..399 CDD:409353 1/3 (33%)
Ig strand E 419..423 CDD:409353 1/3 (33%)
Ig strand F 433..438 CDD:409353 2/4 (50%)
Ig strand G 446..449 CDD:409353 1/2 (50%)
Ig 460..546 CDD:416386 23/93 (25%)
Ig strand A 460..463 CDD:409353 0/2 (0%)
Ig strand A' 467..470 CDD:409353 0/2 (0%)
Ig strand B 476..483 CDD:409353 4/6 (67%)
Ig strand C 489..494 CDD:409353 1/4 (25%)
Ig strand C' 496..498 CDD:409353 0/1 (0%)
Ig strand D 505..509 CDD:409353 2/7 (29%)
Ig strand E 512..517 CDD:409353 2/4 (50%)
Ig strand F 525..533 CDD:409353 4/7 (57%)
Ig strand G 536..546 CDD:409353 1/11 (9%)
Ig 553..637 CDD:416386 25/86 (29%)
Ig strand A 553..556 CDD:409353 0/2 (0%)
Ig strand A' 558..562 CDD:409353 0/3 (0%)
Ig strand B 565..574 CDD:409353 1/9 (11%)
Ig strand C 582..587 CDD:409353 2/5 (40%)
Ig strand C' 590..593 CDD:409353 0/2 (0%)
Ig strand D 597..602 CDD:409353 3/4 (75%)
Ig strand E 603..609 CDD:409353 1/5 (20%)
Ig strand F 616..624 CDD:409353 4/7 (57%)
Ig strand G 627..637 CDD:409353 3/9 (33%)
FN3 651..741 CDD:238020 23/102 (23%)
fn3 754..836 CDD:394996 25/102 (25%)
fn3 852..944 CDD:394996 3/14 (21%)
fn3 957..1041 CDD:394996
fn3 1075..1143 CDD:394996
Bravo_FIGEY 1198..1287 CDD:404722
bdlNP_608822.1 IG_like 42..128 CDD:214653 12/66 (18%)
Ig 43..131 CDD:299845 12/69 (17%)
I-set 153..242 CDD:254352 22/93 (24%)
Ig 157..242 CDD:299845 22/89 (25%)
Ig_2 252..337 CDD:290606 25/96 (26%)
IG_like 260..327 CDD:214653 23/70 (33%)
I-set 341..428 CDD:254352 25/87 (29%)
IGc2 356..419 CDD:197706 20/63 (32%)
FN3 435..524 CDD:238020 21/94 (22%)
FN3 554..636 CDD:238020 23/100 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.