DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and CanA-14F

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001245717.1 Gene:CanA-14F / 8674098 FlyBaseID:FBgn0267912 Length:584 Species:Drosophila melanogaster


Alignment Length:295 Identity:110/295 - (37%)
Similarity:176/295 - (59%) Gaps:23/295 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NDLLNK--LMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLL 95
            :|:|.:  ::..|..:...|.:::....||.|        |..::::.||:.|.||||||||||:
  Fly   117 HDVLKQHFILEGRIEESAALRIIQEGATLLRT--------EKTMIDIEAPVTVCGDIHGQFYDLM 173

  Fly    96 KILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFD 160
            |:.:..|.|..|:|||||||||||..|:|.:..|.:|::.:|:.::|||||||.:.:...:.|..
  Fly   174 KLFEIGGSPATTKYLFLGDYVDRGYFSIECVLYLWSLKITYPQTLFLLRGNHECRHLTEYFTFKQ 238

  Fly   161 ECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCD 225
            |||.:|:.:::...:|.::|:|:||:::.:..|.||||||::.||.:|..:.|..|.|..|.:||
  Fly   239 ECKIKYSERVYDACMDAFDCLPLAALMNQQFLCVHGGLSPEIHELEDIRRLDRFKEPPAFGPMCD 303

  Fly   226 LLWSDP-DRYG------FGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKR 283
            |||||| :.:|      |...:|.||.||.|.......|||.|:...:.|||:..:.||..:.|.
  Fly   304 LLWSDPLEDFGNEKNSDFYTHNSVRGCSYFYSYAACCDFLQNNNLLSIIRAHEAQDAGYRMYRKS 368

  Fly   284 Q------LVTVFSAPNYCGLYDNAGASMGVDKDLV 312
            |      |:|:||||||..:|:|..|.:..:.:::
  Fly   369 QTTGFPSLITIFSAPNYLDVYNNKAAVLKYENNVM 403

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 106/275 (39%)
PP2Ac 54..315 CDD:197547 106/272 (39%)
CanA-14FNP_001245717.1 MPP_PP2B 115..419 CDD:277361 110/295 (37%)
PP2Ac 132..403 CDD:197547 107/278 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438875
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.