DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and GLC7

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_011059.3 Gene:GLC7 / 856870 SGDID:S000000935 Length:312 Species:Saccharomyces cerevisiae


Alignment Length:289 Identity:171/289 - (59%)
Similarity:235/289 - (81%) Gaps:1/289 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNLNDLLNKLMSFRRSKM-QRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYD 93
            :::::::::|:..|.||. |::.|.|:|:..||:.||.:|:.:|:||.:.|||::.||||||:||
Yeast     6 VDVDNIIDRLLEVRGSKPGQQVDLEENEIRYLCSKARSIFIKQPILLELEAPIKICGDIHGQYYD 70

  Fly    94 LLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGF 158
            ||::.:..|:||::.||||||||||||.|:|||.||||.::|:|::.::||||||..|:||:|||
Yeast    71 LLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFILRGNHECASINRIYGF 135

  Fly   159 FDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLL 223
            :|||||||.:||||||.||:||:|:||||..:|||.||||||.|..:..|..:.|||::|:.|||
Yeast   136 YDECKRRYNIKLWKTFTDCFNCLPIAAIIDEKIFCMHGGLSPDLNSMEQIRRVMRPTDIPDVGLL 200

  Fly   224 CDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTV 288
            |||||||||:...||:.:|||||:.:|.||:.:||||.|.:|:||||||||||||||:||||||:
Yeast   201 CDLLWSDPDKDIVGWSENDRGVSFTFGPDVVNRFLQKQDMELICRAHQVVEDGYEFFSKRQLVTL 265

  Fly   289 FSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            ||||||||.:|||||.|.||:.|:.||.|
Yeast   266 FSAPNYCGEFDNAGAMMSVDESLLCSFQI 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 165/265 (62%)
PP2Ac 54..315 CDD:197547 162/260 (62%)
GLC7NP_011059.3 MPP_PP1_PPKL 7..297 CDD:277359 171/288 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.780

Return to query results.
Submit another query.