DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPZ2

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_010724.1 Gene:PPZ2 / 852046 SGDID:S000002844 Length:710 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:153/290 - (52%)
Similarity:212/290 - (73%) Gaps:2/290 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 LNLNDLLNKLM--SFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFY 92
            :::::::.:|:  .:...:.:.:.|..||:..:|..||||||.:|.||.:...:::|||:|||:.
Yeast   396 VDIDEIIQRLLDAGYAAKRTKNVCLKNSEIIQICHKARELFLAQPALLELSPSVKIVGDVHGQYA 460

  Fly    93 DLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYG 157
            |||::..:||:||...||||||||||||.|:|||.|||..::|:|::.:|||||||..:|.||||
Yeast   461 DLLRLFTKCGFPPMANYLFLGDYVDRGKQSLETILLLLCYKIKYPENFFLLRGNHECANVTRVYG 525

  Fly   158 FFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGL 222
            |:||||||..:|:||||||.:|.:|:|||::.:|||.||||||.|..:..|..::|||:||:.||
Yeast   526 FYDECKRRCNIKIWKTFVDTFNTLPLAAIVTGKIFCVHGGLSPVLNSMDEIRHVSRPTDVPDFGL 590

  Fly   223 LCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVT 287
            :.|||||||......|..::||||:.|.:..:.|||.|..||||||||.|||||||||..|.|||
Yeast   591 INDLLWSDPTDSSNEWEDNERGVSFCYNKVAINKFLNKFGFDLVCRAHMVVEDGYEFFNDRSLVT 655

  Fly   288 VFSAPNYCGLYDNAGASMGVDKDLVISFDI 317
            |||||||||.:||.||.|.|.:.|:.||::
Yeast   656 VFSAPNYCGEFDNWGAVMTVSEGLLCSFEL 685

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 152/265 (57%)
PP2Ac 54..315 CDD:197547 149/260 (57%)
PPZ2NP_010724.1 MPP_PP1_PPKL 397..688 CDD:277359 153/289 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.670

Return to query results.
Submit another query.