DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and PPH21

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_010147.1 Gene:PPH21 / 851421 SGDID:S000002292 Length:369 Species:Saccharomyces cerevisiae


Alignment Length:295 Identity:128/295 - (43%)
Similarity:190/295 - (64%) Gaps:3/295 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SEANADYRLPGALNLNDL-LNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPI 81
            |...||::....|.||:. :|:|..:.....:..||.|.:|..||.:|.::...|..:..:..|:
Yeast    48 SSGIADHKSSKPLELNNTNINQLDQWIEHLSKCEPLSEDDVARLCKMAVDVLQFEENVKPINVPV 112

  Fly    82 RVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGN 146
            .:.||:||||:|||::....|..|.|.|||:|||||||..||||::.|:|::|::|..|.:||||
Yeast   113 TICGDVHGQFHDLLELFKIGGPCPDTNYLFMGDYVDRGYYSVETVSYLVAMKVRYPHRITILRGN 177

  Fly   147 HESQSVNRVYGFFDECKRRY-TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIES 210
            |||:.:.:||||:|||.|:| :..:||.|.|.::..|:.|::.::|||.||||||.::.:..:..
Yeast   178 HESRQITQVYGFYDECLRKYGSANVWKMFTDLFDYFPITALVDNKIFCLHGGLSPMIETIDQVRE 242

  Fly   211 IARPTEVPETGLLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVED 275
            :.|..|||..|.:|||||||||..| ||..|.||..:.:|:||.|:|...||..|:.||||:|.:
Yeast   243 LNRIQEVPHEGPMCDLLWSDPDDRG-GWGISPRGAGFTFGQDVSEQFNHTNDLSLIARAHQLVME 306

  Fly   276 GYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKD 310
            ||.:..::.:||:|||||||....|..|.|.||::
Yeast   307 GYAWSHQQNVVTIFSAPNYCYRCGNQAAIMEVDEN 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 120/261 (46%)
PP2Ac 54..315 CDD:197547 118/258 (46%)
PPH21NP_010147.1 MPP_PP2A_PP4_PP6 70..352 CDD:277360 121/273 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157341469
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.