DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and CNA1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_013537.1 Gene:CNA1 / 851153 SGDID:S000004425 Length:553 Species:Saccharomyces cerevisiae


Alignment Length:290 Identity:103/290 - (35%)
Similarity:161/290 - (55%) Gaps:28/290 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQT 107
            |.||.|.:.:|.     :.|:|   ...||.||.:.|||.:.||||||:|||||:.:..|.|.:.
Yeast    84 RLSKEQAIKILN-----MSTVA---LSKEPNLLKLKAPITICGDIHGQYYDLLKLFEVGGDPAEI 140

  Fly   108 RYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWK 172
            .|||||||||||..|.|.:..|.:|::......::||||||.:.:...:.|.:|...:|.::::.
Yeast   141 DYLFLGDYVDRGAFSFECLIYLYSLKLNNLGRFWMLRGNHECKHLTSYFTFKNEMLHKYDMEVYD 205

  Fly   173 TFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDP------ 231
            .....:|.:|:||:::.:.||.|||:||:||.:.::..|.|..|:|..||:|||||:||      
Yeast   206 ACCRSFNVLPLAALMNGQYFCVHGGISPELKSVEDVNKINRFREIPSRGLMCDLLWADPVENYDD 270

  Fly   232 DRYGFGWTSSD--------RGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQ---- 284
            .|.|..:..|:        ||.|:.:......|||:.|....:.|||:..:.||..:...:    
Yeast   271 ARDGSEFDQSEDEFVPNSLRGCSFAFTFKASCKFLKANGLLSIIRAHEAQDAGYRMYKNNKVTGF 335

  Fly   285 --LVTVFSAPNYCGLYDNAGASMGVDKDLV 312
              |:|:||||||...|.|..|.:..:::::
Yeast   336 PSLITMFSAPNYLDTYHNKAAVLKYEENVM 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 99/282 (35%)
PP2Ac 54..315 CDD:197547 98/279 (35%)
CNA1NP_013537.1 MPP_PP2B 70..381 CDD:277361 103/290 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.