DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and BSU1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_171844.6 Gene:BSU1 / 838804 AraportID:AT1G03445 Length:793 Species:Arabidopsis thaliana


Alignment Length:302 Identity:124/302 - (41%)
Similarity:187/302 - (61%) Gaps:24/302 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 DLLNKLMS-FRRSKMQRLP------LLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQF 91
            ||..|::| ..|.|....|      |...||..||....::|::||.||.:..||:|.||||||:
plant   451 DLHKKVISTLLRPKTWTPPANRDFFLSYLEVKHLCDEVEKIFMNEPTLLQLKVPIKVFGDIHGQY 515

  Fly    92 YDLLKILDQCGYP------PQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQ 150
            .||:::..:.|:|      ....|||||||||||::|:|.|.||.||::::||:|:|:||||||.
plant   516 GDLMRLFHEYGHPSVEGDITHIDYLFLGDYVDRGQHSLEIIMLLFALKIEYPKNIHLIRGNHESL 580

  Fly   151 SVNRVYGFFDECKRR----YTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESI 211
            ::||:|||..||:.|    |..:.|......::.:|:||::..::.|.|||:. :...:..||:|
plant   581 AMNRIYGFLTECEERMGESYGFEAWLKINQVFDYLPLAALLEKKVLCVHGGIG-RAVTIEEIENI 644

  Fly   212 ARPTEVPETG--LLCDLLWSDPDRYG--FGWTSSDRGVSYL-YGRDVLEKFLQKNDFDLVCRAHQ 271
            .||. .|:||  :|.|:|||||....  .|...:.||...: :|.|:::.||::|..:::.|||:
plant   645 ERPA-FPDTGSMVLKDILWSDPTMNDTVLGIVDNARGEGVVSFGPDIVKAFLERNGLEMILRAHE 708

  Fly   272 VVEDGYEFFAKRQLVTVFSAPNYCGLYDNAGASMGVDKDLVI 313
            .|.||:|.||..:|:|||||.||||...||||.:.:.:|:||
plant   709 CVIDGFERFADGRLITVFSATNYCGTAQNAGAILVIGRDMVI 750

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 118/284 (42%)
PP2Ac 54..315 CDD:197547 116/275 (42%)
BSU1NP_171844.6 PLN02193 <26..294 CDD:177844
KELCH repeat 31..92 CDD:276965
KELCH repeat 99..147 CDD:276965
KELCH repeat 202..249 CDD:276965
KELCH repeat 253..315 CDD:276965
MPP_superfamily 456..757 CDD:387346 121/297 (41%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.