DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and TOPP6

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_851123.1 Gene:TOPP6 / 834356 AraportID:AT5G43380 Length:331 Species:Arabidopsis thaliana


Alignment Length:298 Identity:172/298 - (57%)
Similarity:231/298 - (77%) Gaps:2/298 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PGALNLNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQF 91
            ||  .||.::|:|:..|....:.:.|.|:|:..||.::|::||.:|.||.:.||:::.||||||:
plant     3 PG--TLNSVINRLLEAREKPGKIVQLSETEIKQLCFVSRDIFLRQPNLLELEAPVKICGDIHGQY 65

  Fly    92 YDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVY 156
            .|||::.:..||||.:.||||||||||||.|:|||.||||.::|||::.:||||||||.|:||:|
plant    66 PDLLRLFEHGGYPPNSNYLFLGDYVDRGKQSLETICLLLAYKIKFPENFFLLRGNHESASINRIY 130

  Fly   157 GFFDECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETG 221
            ||:||||||::||:|:.|.||:||:||||:|..||||.||||||:|..|..|..|.|||::|:.|
plant   131 GFYDECKRRFSVKIWRIFTDCFNCLPVAALIDERIFCMHGGLSPELLSLRQIRDIRRPTDIPDRG 195

  Fly   222 LLCDLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLV 286
            |||||||||||:...||..:||||||.:|.|::..||::.|.||:||||||||||:||||.:|||
plant   196 LLCDLLWSDPDKDVRGWGPNDRGVSYTFGSDIVSGFLKRLDLDLICRAHQVVEDGFEFFANKQLV 260

  Fly   287 TVFSAPNYCGLYDNAGASMGVDKDLVISFDIQRGDIRR 324
            |:||||||||.:|||||.|.|.:||..||.|.:.:.::
plant   261 TIFSAPNYCGEFDNAGAMMSVSEDLTCSFQILKSNDKK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 164/265 (62%)
PP2Ac 54..315 CDD:197547 161/260 (62%)
TOPP6NP_851123.1 PTZ00480 6..297 CDD:185658 170/290 (59%)
MPP_PP1_PPKL 6..293 CDD:277359 170/286 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.790

Return to query results.
Submit another query.