DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and TOPP7

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_567375.1 Gene:TOPP7 / 826726 AraportID:AT4G11240 Length:322 Species:Arabidopsis thaliana


Alignment Length:294 Identity:169/294 - (57%)
Similarity:224/294 - (76%) Gaps:1/294 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNDLLNKLMSFRRSK-MQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLL 95
            |:|::.:|::....: :::..:.|:|:..||..::|:||.:|.||.:.|||::.||:||||.|||
plant     6 LDDIIRRLLATNNGRTVKQAQITETEIRQLCLASKEVFLSQPNLLELEAPIKICGDVHGQFPDLL 70

  Fly    96 KILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFD 160
            ::.:..||||...||||||||||||.|:|||.||||.:||:..:.:|||||||..|:||||||:|
plant    71 RLFEYGGYPPAANYLFLGDYVDRGKQSIETICLLLAYKVKYKFNFFLLRGNHECASINRVYGFYD 135

  Fly   161 ECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCD 225
            ||||||.|:|||||.:|:||:||:|:|..:|.|.||||||.:|.|.:|..|.||.:||:.|:|||
plant   136 ECKRRYNVRLWKTFTECFNCLPVSALIDDKILCMHGGLSPDIKSLDDIRRIPRPIDVPDQGILCD 200

  Fly   226 LLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFS 290
            |||:||||...||..:||||||.:|.|.:.:|||.:|.||:|||||||||||||||||||||:||
plant   201 LLWADPDREIQGWGENDRGVSYTFGADKVAEFLQTHDLDLICRAHQVVEDGYEFFAKRQLVTIFS 265

  Fly   291 APNYCGLYDNAGASMGVDKDLVISFDIQRGDIRR 324
            ||||||.:|||||.|.||..|..||.|.:...::
plant   266 APNYCGEFDNAGALMSVDDSLTCSFQILKASEKK 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 165/265 (62%)
PP2Ac 54..315 CDD:197547 163/260 (63%)
TOPP7NP_567375.1 MPP_PP1_PPKL 6..294 CDD:277359 169/287 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 1 1.100 - - O PTHR11668
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.790

Return to query results.
Submit another query.