DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and TOPP5

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_190266.1 Gene:TOPP5 / 823835 AraportID:AT3G46820 Length:312 Species:Arabidopsis thaliana


Alignment Length:295 Identity:173/295 - (58%)
Similarity:227/295 - (76%) Gaps:2/295 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNDLLNKLMSFRRSK--MQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDL 94
            |:|::.:|:.:|..|  .::..|.:||:..||.::||:||.:|.||.:.||:::.||||||:.||
plant    14 LDDIIRRLLDYRNPKAGTKQAMLNDSEIRQLCFVSREIFLQQPCLLELAAPVKICGDIHGQYSDL 78

  Fly    95 LKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFF 159
            |::.:..|:||...||||||||||||.|:|||.||||.::|:|::.:|||||||..|:||:|||:
plant    79 LRLFEYGGFPPAANYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFY 143

  Fly   160 DECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLC 224
            ||||||:.|||||.|.|.:||:||||:|..:|.|.||||||:|..:..|::|.|||:||:.||||
plant   144 DECKRRFNVKLWKVFTDTFNCLPVAAVIDEKILCMHGGLSPELINVEQIKNIERPTDVPDAGLLC 208

  Fly   225 DLLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVF 289
            |||||||.:...||..:||||||.:|.|.:.:||.|||.||||||||||||||||||.|||||:|
plant   209 DLLWSDPSKDVKGWGMNDRGVSYTFGADKVAEFLIKNDMDLVCRAHQVVEDGYEFFADRQLVTMF 273

  Fly   290 SAPNYCGLYDNAGASMGVDKDLVISFDIQRGDIRR 324
            |||||||.:|||||.|.||:.|:.||.|.:...||
plant   274 SAPNYCGEFDNAGALMSVDESLMCSFQILKPVDRR 308

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 165/265 (62%)
PP2Ac 54..315 CDD:197547 162/260 (62%)
TOPP5NP_190266.1 MPP_PP1_PPKL 13..304 CDD:277359 171/289 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.690

Return to query results.
Submit another query.