DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and AT3G09970

DIOPT Version :10

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_566364.1 Gene:AT3G09970 / 820158 AraportID:AT3G09970 Length:309 Species:Arabidopsis thaliana


Alignment Length:80 Identity:27/80 - (33%)
Similarity:40/80 - (50%) Gaps:11/80 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PAPIRVVGDIHGQ-------FYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVK 135
            |..:..||||||.       :.:|...:|...: .....:|||||.|||..:.:.|..|::|..|
plant     5 PRTVICVGDIHGYISKLNNLWLNLQSAIDPSDF-SSALVIFLGDYCDRGPETRKVIDFLISLPEK 68

  Fly   136 FP--KHIYLLRGNHE 148
            .|  .|:: |.|||:
plant    69 HPDQTHVF-LAGNHD 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:472684 27/80 (34%)
AT3G09970NP_566364.1 MPP_Rhilphs 5..308 CDD:163664 27/80 (34%)

Return to query results.
Submit another query.