DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and AT3G09960

DIOPT Version :10

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_566363.1 Gene:AT3G09960 / 820157 AraportID:AT3G09960 Length:311 Species:Arabidopsis thaliana


Alignment Length:85 Identity:28/85 - (32%)
Similarity:41/85 - (48%) Gaps:11/85 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 MLLNVPAPIRVVGDIHGQFYDLLKI-------LDQCGYPPQTRYLFLGDYVDRGKNSVETITLLL 130
            |:...|..:..||||||....|.|:       :....: .....:|||||.|||..:.:.|..|:
plant     1 MMTQKPRTVICVGDIHGNISKLNKLWLNLQSDIQNSDF-SSALVIFLGDYCDRGPETRKVIDFLI 64

  Fly   131 ALRVKFP--KHIYLLRGNHE 148
            :|..|.|  .|:: |.|||:
plant    65 SLPEKHPDQTHVF-LAGNHD 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:472684 28/85 (33%)
AT3G09960NP_566363.1 MPP_Rhilphs 6..310 CDD:163664 27/80 (34%)

Return to query results.
Submit another query.