DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and TOPP4

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_181514.1 Gene:TOPP4 / 818571 AraportID:AT2G39840 Length:321 Species:Arabidopsis thaliana


Alignment Length:287 Identity:171/287 - (59%)
Similarity:223/287 - (77%) Gaps:1/287 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNDLLNKLMSFRRSKM-QRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLL 95
            |:|::.:|...|.::. :::.|.|:|:..|||.||::||.:|.||.:.|||::.||||||:.|||
plant    19 LDDIIRRLTEVRLARPGKQVQLSEAEIKQLCTTARDIFLQQPNLLELEAPIKICGDIHGQYSDLL 83

  Fly    96 KILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFD 160
            ::.:..|:||...||||||||||||.|:|||.||||.::|:|.:.:|||||||..|:||:|||:|
plant    84 RLFEYGGFPPSANYLFLGDYVDRGKQSLETICLLLAYKIKYPGNFFLLRGNHECASINRIYGFYD 148

  Fly   161 ECKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCD 225
            |||||:.|::||.|.||:||:||||:|..:|.|.||||||.|..|..|.::.|||.:|:||||||
plant   149 ECKRRFNVRVWKVFTDCFNCLPVAALIDDKILCMHGGLSPDLDHLDEIRNLPRPTMIPDTGLLCD 213

  Fly   226 LLWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFS 290
            ||||||.:...||..:||||||.:|.|.:.:||.|:|.||||||||||||||||||.||||||||
plant   214 LLWSDPGKDVKGWGMNDRGVSYTFGPDKVSEFLTKHDLDLVCRAHQVVEDGYEFFADRQLVTVFS 278

  Fly   291 APNYCGLYDNAGASMGVDKDLVISFDI 317
            ||||||.:|||||.|.||::|:.||.|
plant   279 APNYCGEFDNAGAMMSVDENLMCSFQI 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 166/265 (63%)
PP2Ac 54..315 CDD:197547 163/260 (63%)
TOPP4NP_181514.1 MPP_PP1_PPKL 18..308 CDD:277359 171/287 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 1 1.010 - - D766640at2759
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100222
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.690

Return to query results.
Submit another query.