DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and ppp3ca

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001185479.1 Gene:ppp3ca / 794574 ZFINID:ZDB-GENE-091113-24 Length:521 Species:Danio rerio


Alignment Length:332 Identity:121/332 - (36%)
Similarity:184/332 - (55%) Gaps:46/332 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 ANADYRLPGALNLNDLLNKLMSFRRSKMQRLPLLE-------SEVNLL-CTLARE---------- 66
            :|||.    .||..|.:.|.:.|..|  .||.:.|       ..|:|| ..|.:|          
Zfish     4 SNADM----VLNSTDRVVKSVPFPLS--HRLTMKEVFDCEGKPRVDLLKAHLTKEGRVEETVALR 62

  Fly    67 -------LFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQCGYPPQTRYLFLGDYVDRGKNSVE 124
                   :...|..:|::.||:.|.|||||||:||:|:.:..|.|..|||||||||||||..|:|
Zfish    63 IINEGASILRQEKTMLDIEAPVTVCGDIHGQFFDLMKLFEVGGSPATTRYLFLGDYVDRGYFSIE 127

  Fly   125 TITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRRYTVKLWKTFVDCYNCMPVAAIISH 189
            .:..|.:|::.:||.::|||||||.:.:...:.|..|||.:|:.:::.:.:|.::|:|:||:::.
Zfish   128 CVLYLWSLKILYPKTLFLLRGNHECRHLTEYFTFKQECKIKYSEQVYDSCMDAFDCLPLAALMNQ 192

  Fly   190 RIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWSDPDRYGFGWTSSD--------RGVS 246
            :..|.||||||:::.|.:|:.:.|..|.|..|.:|||||||| ...||...|.        ||.|
Zfish   193 QFLCVHGGLSPEIQTLDDIKKLDRFKEPPAFGPMCDLLWSDP-LEDFGNEKSQEYFSHNTVRGCS 256

  Fly   247 YLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQ------LVTVFSAPNYCGLYDNAGASM 305
            |.|....:..|||.|:...:.|||:..:.||..:.|.|      |:|:||||||..:|:|..|.:
Zfish   257 YFYSYPAVCDFLQNNNLLSIIRAHEAQDAGYRMYRKSQTTGFPSLITIFSAPNYLDVYNNKAAVL 321

  Fly   306 GVDKDLV 312
            ..:.:::
Zfish   322 KYENNVM 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 110/301 (37%)
PP2Ac 54..315 CDD:197547 110/298 (37%)
ppp3caNP_001185479.1 MPP_PP2B 40..344 CDD:277361 109/290 (38%)
PP2Ac 59..328 CDD:197547 104/269 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.