DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Ppp6c

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_077171.1 Gene:Ppp6c / 67857 MGIID:1915107 Length:305 Species:Mus musculus


Alignment Length:300 Identity:130/300 - (43%)
Similarity:183/300 - (61%) Gaps:10/300 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLKILDQ 100
            |:|.:...| :.:.||  |:::..||....:|.|:|..:..|..|:.|.||||||||||.::...
Mouse     6 LDKYVEIAR-QCKYLP--ENDLKRLCDYVCDLLLEESNVQPVSTPVTVCGDIHGQFYDLCELFRT 67

  Fly   101 CGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDECKRR 165
            .|..|.|.|:|:||:||||..|:||.|.||||:.|:|..|.||||||||:.:.:||||:|||:.:
Mouse    68 GGQVPDTNYIFMGDFVDRGYYSLETFTYLLALKAKWPDRITLLRGNHESRQITQVYGFYDECQTK 132

  Fly   166 Y-TVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDLLWS 229
            | ....|:.....::.:.|||:|..:|.|.||||||.:|.|..|.:|.|..|:|..|..|||:||
Mouse   133 YGNANAWRYCTKVFDMLTVAALIDEQILCVHGGLSPDIKTLDQIRTIERNQEIPHKGAFCDLVWS 197

  Fly   230 DPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSAPNY 294
            ||:... .|..|.||..:|:|..|..:|:..|:..|:|||||:|.:||:|....:||||:|||||
Mouse   198 DPEDVD-TWAISPRGAGWLFGAKVTNEFVHINNLKLICRAHQLVHEGYKFMFDEKLVTVWSAPNY 261

  Fly   295 CGLYDNAGASMGVDKDLVISFDIQRGDIRRIVVRNESVSP 334
            |....|. ||:.|.||:    :.:...:.|.|..:|.|.|
Mouse   262 CYRCGNI-ASIMVFKDV----NTREPKLFRAVPDSERVIP 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 121/266 (45%)
PP2Ac 54..315 CDD:197547 120/261 (46%)
Ppp6cNP_077171.1 MPP_PP2A_PP4_PP6 5..289 CDD:277360 126/291 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0639
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53795
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.