DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PpD6 and Pp1-Y1

DIOPT Version :9

Sequence 1:NP_524947.1 Gene:PpD6 / 49780 FlyBaseID:FBgn0005779 Length:336 Species:Drosophila melanogaster
Sequence 2:NP_001104152.3 Gene:Pp1-Y1 / 5740113 FlyBaseID:FBgn0261399 Length:317 Species:Drosophila melanogaster


Alignment Length:288 Identity:169/288 - (58%)
Similarity:223/288 - (77%) Gaps:2/288 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LNDLLNKLMSFRRSKMQRLPLLESEVNLLCTLARELFLDEPMLLNVPAPIRVVGDIHGQFYDLLK 96
            |::::..|:|::..:...:|  ||::..|...||::.:.|||||.|.||:.|:||||||:.|||:
  Fly    17 LDEMIASLLSWKIDRKMMVP--ESDIIKLLKQARQVLMSEPMLLTVEAPVNVLGDIHGQYNDLLR 79

  Fly    97 ILDQCGYPPQTRYLFLGDYVDRGKNSVETITLLLALRVKFPKHIYLLRGNHESQSVNRVYGFFDE 161
            ..:..|:||:.|||.|||||||||.||||:|||||.:|::|..|:||||||||.::||.|||:||
  Fly    80 YFETSGHPPKKRYLMLGDYVDRGKYSVETLTLLLAYKVRYPTSIHLLRGNHESAAINRYYGFYDE 144

  Fly   162 CKRRYTVKLWKTFVDCYNCMPVAAIISHRIFCCHGGLSPQLKELSNIESIARPTEVPETGLLCDL 226
            ||||:|::||:.|||||:|:||||||:.:||||||||||.|..|::|:.:.||.||...||||||
  Fly   145 CKRRFTIRLWRMFVDCYDCLPVAAIINSKIFCCHGGLSPSLHNLNDIQHLQRPAEVDRNGLLCDL 209

  Fly   227 LWSDPDRYGFGWTSSDRGVSYLYGRDVLEKFLQKNDFDLVCRAHQVVEDGYEFFAKRQLVTVFSA 291
            ||||||....||..:.||||:.:|.|::|.||.:..|||:|||||||||||||||||||:|||||
  Fly   210 LWSDPDPTAIGWEKNSRGVSFTFGVDIVETFLSRFSFDLICRAHQVVEDGYEFFAKRQLITVFSA 274

  Fly   292 PNYCGLYDNAGASMGVDKDLVISFDIQR 319
            .||||.:|||||.|.||.:|.|:..:.:
  Fly   275 VNYCGEFDNAGAMMCVDAELNITLVVMK 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PpD6NP_524947.1 MPP_superfamily 51..317 CDD:301300 166/265 (63%)
PP2Ac 54..315 CDD:197547 165/260 (63%)
Pp1-Y1NP_001104152.3 MPP_superfamily 17..303 CDD:301300 169/288 (59%)
PP2Ac 36..305 CDD:197547 166/269 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438781
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D327461at33208
OrthoFinder 1 1.000 - - FOG0000018
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11668
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.